KEGG   Uncinocarpus reesii: UREG_04911Help
Entry
UREG_04911        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ure  Uncinocarpus reesii
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ure00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ure00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MFSGALIAMLSKVLLAGVVVLTLSLYWVLVPPRHPRNIPAVPFWVTLLPLFFDVDQENTY
RRYIRKPLQQYGVIKIFFGGQWNLVIQRPTYVAEMFKHEEVYQKSGNQKKIPHSVLAEFL
GDNIISSRGDDWKLYRNIIKPGLQKTFETQPIVANARKLCSLLKKSQQALGSQGILIQNH
IQCYTTANISKCVLQAEIESLSTENDTLMKLQLAVKREIFKPIFMNFPLLDRFGSFIPSR
AHARELVRRFSSELESRLVRDHTEMPDSEASDNVGSRLIAARDRGELTQQQFRDNLNVTF
VAGQENPQLLLISTMYLLGKYPEVQCRLRSEIEGCGADEPSHLILRDMPYLTSVTYESLR
LFPPISQLINRRVAKPVVLGGEIYIPQNTYVGYNCYATNRDPTVWGKTADEFRPERWGST
TKEISMRYRVARARAEFTSFHGGSRACLGETFALLEMKLSLFILLKNLSWRLDPKWEDRK
TPVRNLPRPLF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgggcgccctcattgcaatgctgagcaaagtccttcttgcgggagtggttgtt
cttacactgtcgctctactgggttctcgttccgcctcgtcatcctcgaaatattcccgca
gttccattttgggttactttactcccattattttttgatgttgaccaagagaacacgtat
cgaagatacattcggaagcctttgcaacagtatggagttatcaagattttctttgggggg
caatggaacttggtcatacagagaccgacctacgtggcggaaatgtttaaacatgaggaa
gtttaccagaagagcggaaaccaaaagaagattcctcatagcgtccttgcggaattccta
ggcgacaacattatttcttcgagaggcgacgattggaaactttaccgaaatattatcaag
cccggccttcagaaaacctttgaaacacagcccattgttgccaatgctagaaagctctgc
agtttgctcaaaaaatcgcagcaggccctgggaagtcagggaatattgatccagaatcat
atccagtgctacacaactgcaaatatatcaaagtgcgtcttgcaggctgagatagagtcg
ctgtcaactgaaaatgacacactcatgaaattgcagctcgcagtgaagagagaaattttc
aagcctattttcatgaatttccctctgttggatcgatttggttccttcatacctagtcgt
gcccacgcaagagagttagtacgaagattttctagtgagttggagtcaaggctagtccgg
gatcacactgagatgccggattccgaagcatctgacaacgttggatcacgattaattgcc
gctagagatcgtggtgaattaacacagcaacaatttcgggacaacctgaacgttacattt
gttgctgggcaggaaaacccgcaactccttctgatttcaacaatgtacctgctaggaaaa
tatcccgaagttcaatgtcgtctaagatctgaaattgagggctgtggagcggatgagccg
tcccacctcattttgcgcgacatgccatatctcacttccgtcacctatgagagcctccga
ttgtttccgcctatctcccagctaatcaatcgacgagtggctaagccagttgttttgggg
ggcgagatctatatccctcaaaatacgtacgtaggatacaactgttatgcaactaatcgg
gatcccactgtttggggcaaaaccgcagacgaatttaggcccgaacgatggggctcaacc
accaaagaaatttctatgcggtatagggtcgcgagggcacgggcagaatttacctcgttc
catggaggtagccgtgcgtgtctcggggagacctttgcgttgctggaaatgaaactttcg
ctttttattctgctgaagaatttgagctggaggttggaccccaagtgggaagaccgcaag
accccagtaagaaacctaccacgccctcttttttag

DBGET integrated database retrieval system