KEGG   Uncinocarpus reesii: UREG_04929Help
Entry
UREG_04929        CDS       T01132                                 

Definition
longevity-assurance protein 1
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ure  Uncinocarpus reesii
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ure00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MATATSESPKSHKSRSLRSPSEKTVHTHSKRRRARSVFRQLKNTCLRHTWLLPLILLTII
LSAYLVNPNESNPIHKLLFLSYALPPETPGGPVMYGKGPADLAFFGFYIIVLSFTREFLM
QCMIKPLARRWGIKGKAKTARFLEQFYTAIYFSVFGPYGLYVMSRTKIWYFNTTPMFEGF
PHKTHTADFKAYYLIQASYWAQQAIVLLLLLEKPRKDFKELVGHHIVTLALIGLSYRFHF
TYIGLAVYITHDISDFFLATSKTLNYLDSSFMGPYFALFVFVWIYMRHYLNLRIIWAVLT
EFRTVGPFELNWDTQQYKCWISQYITFSLLSALQAINLIWLFFILRIAKNYVFNNIKQDE
RSDNEEDDEVDDIPVLNESQNSTSVPTIVLNGNNPATARRRNPDKENEVPNNSITSRANG
AMMKSHVETTTAAMNGNKVK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgctacttcagaatctcccaagtcccacaagagccgctctcttcgatcgccc
tctgaaaagaccgtacacactcactcgaaacgacggcgtgcgagatctgtgtttcgccag
ctcaaaaatacttgccttaggcacacatggctactacctctcatcctattgacaattata
ctctcagcatatctggtgaacccgaacgagtctaatccaatccacaagctccttttcctc
tcttatgcgcttccgcccgagactcccggtggccctgtgatgtatgggaagggcccagcg
gacttagcgtttttcggcttctacatcatagtcctttccttcacgcgtgaattcttgatg
caatgcatgattaaacccttggcacgtcgatggggaataaagggaaaggccaagactgcg
cggttcttggaacaattctacacagctatctactttagcgtctttgggccttatggacta
tacgttatgagccgcaccaaaatttggtactttaacacaacacccatgtttgaaggattt
ccacataagacgcatacggcggatttcaaggcctattacctgatacaagcgagctactgg
gcgcagcaggccattgtcttgctgttgctgttggagaagccaaggaaggacttcaaggag
cttgtggggcatcatatagtcacattggcattgattgggctcagttatcgcttccacttc
acctacattggccttgcggtgtatatcactcatgacatatcggactttttcctcgcaact
tcgaagactttgaattacctggattcttcgttcatgggcccgtacttcgcacttttcgtt
ttcgtttggatttacatgcggcattacctaaacctccgcataatctgggctgttttgacc
gagttccgtaccgttgggccctttgaacttaactgggacacgcaacaatacaaatgctgg
attagccagtatattacgttctcccttttgagcgcactccaggcgatcaatctgatttgg
ctcttcttcatccttcgaatcgccaagaactacgttttcaacaatataaaacaggacgaa
agaagcgacaatgaagaagacgatgaggttgatgatattcccgtactcaacgaatctcag
aattcgacgagcgtcccaaccattgtgttaaatgggaataatccggcaacggccagaaga
agaaaccccgacaaggaaaacgaagtcccgaacaactctatcacgagccgagctaatggt
gctatgatgaaatctcatgtggagaccacgacggctgcaatgaacggcaataaggtgaaa
tga

DBGET integrated database retrieval system