KEGG   Uncinocarpus reesii: UREG_04999Help
Entry
UREG_04999        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ure  Uncinocarpus reesii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ure03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1644 aa AA seqDB search
MDGDPVLDGLRGLYQDLSALSRNALPNVERLVFELEATVDDFRKLLDKVPKKNESRKAVL
SGKIDLEGVEYSLNDAFQQDVLQVADALDIDEVQAASYYMQAQLDTIKLDRSPVMVAIIH
FHERRAFLLECLRLVLHESFEIEREDTRALMQDIVAMVLEIQNGPLRNGSLYARKCMDSM
GDIEKWLVLLGEQIQKASIVGVAQDSDVLEVLEYQRQSLGKQHESLGAILYYLFKGTFTS
SEDFRKLLEKLKKAERFDMLLVHHLPALISAISQYGSSEGQGPLREARSLHLTIAGNKES
ANWVLPKFHAAVVVFWLAEYSGWFFDSGPVSPLQGINPAHELSALTQTFMSSLDAGGLEF
ILLVCAGVAGEEWDVPARNELVSLILKDAQRLSVEPDRPTAYFHELLMVGLEAFTESLIA
NMPDAIRHLKSEEDSQRLDQMTALRETANASLHRGLIEPRMHLESLLVIIAFTFDKRDEP
AQEFWADTDGNLYGFLQWVSKRQTVPRVSAFCEMLCSLSGGEENSASAHSFLQDEDSSSS
KFRRSISMNWDQMFAELQLYATRVTERPPASQPSVLRNRKPETVDIDEPESPVMLTCYLR
LISHLCKENTQIREWILKYPTANIANTLLTLCAAPIPHYLRASIFVTLRCIMLQRTTTHG
NEMWTLIDQWISGSGASPLSLTKLPVLTSSPTLNERHVFQRIMESFDQTNAFVDLLIVLT
SPTVDSGDSQICLQFPESLGSSYQGKEARLLQCNCLSFVAINLESFNENLVSLVNQTTVS
SHTTIGNVPLQTYLRLHPFSRIMEWLFNEDVLRALFACSHQDIEDVAQASSDSVLLQALI
KSIDVMNMIMYHQATFFNIVRPFVRSFPHQGKSNMANTSLASFEDSVMDNLSLITDLCLY
CGTGHPQLTLTSLALLEKLSASRKLNKPTAIFQWQTPNQLVELLNSNVDADRIARSLASQ
MVPDMRELENGPTAAGYLIKLGLVQLLDKCLNMIPNKPTIAHVLLGFRCIGNPLDVASDS
LFEKGLSLLHAIIDLVKAYPDGGDGTIISWMIHLKQLAFHVLQCLWTSSLSSALVLPQLR
ANRLLANLLASQAIIAPDSLWDGFRITESDFWFSESAVGLSEFLVYRSLLFDYATTETRA
VFKESSPSFQRDTLSTLLGNSTSEDGTIISHPSIFDLFDFADLDVEWEYAFPGLKYFRDV
DLSVCAASQLDGFPVLYDLSSVESLLQLTKDNLLNSGQVSMQEEDQVSTERDKLLLFLRA
SNQNRQIRYNRLVALKSWVELVITIIVNGEMDPTRMATLILHTLQVILPKLESSIIENAA
EATELARLAETLIEKLVSSKGNEDVIDERLHHLFHVCVRGIPSVLEEKALRETLYHICSR
YLSRITKKGGAKVRFGSRAHQIIKSTGSSLIDAVCDDAYSGDENCRISALVFLNLLSVLC
EQQSSSVLVTLISQSNYLLMFLDAVRSMASEFRNTQGAETSQLLVFYEALLSLLQQLSQS
KIGAIHLLDAGLFQAVKESQIFAADPDIGLDIDNPDALHKYFDLLLSVLRVIVAAVFTRG
LHNKQIVEQTRNFLSENRQSMVGIFKRSAKVGGSERTDIQDSLRELVKLYVALIAAVDFL
DFEDQSQQPAVQKIIFIVLFNNEI
NT seq 4935 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgatccagtgctggatggccttcgaggtctttatcaggatctttcggcgctt
tcgaggaacgccttgcccaacgtcgaaagattggtgttcgagttagaagcgacggtcgat
gatttcaggaagctcctggataaagtgcccaagaaaaatgaaagccgaaaagctgttctc
tctggaaaaattgaccttgaaggggttgagtattctctcaacgatgctttccaacaggat
gtattacaggttgcggatgccttagatattgatgaggttcaggctgccagttattatatg
caagcccagttggacacgataaaactagatcgatcgcccgtgatggtcgcaattattcat
tttcacgagcgccgtgcgtttctgctcgaatgccttcgccttgtcctacatgaatcattt
gaaatcgaaagagaagacacccgtgctcttatgcaagacatcgttgcaatggttcttgaa
atacagaatggcccactgcgcaatggttctctctatgccagaaaatgcatggattcgatg
ggagacattgaaaagtggcttgttcttctcggggaacaaatacagaaggcgtccattgta
ggggtggcccaagattcggatgtgttggaagtactcgaatatcaacgtcagagcctaggc
aaacaacatgagtccctcggggcaattctatactatctttttaaggggacgttcacgagc
tctgaggactttcggaaactgcttgaaaaactgaagaaggccgagaggttcgatatgctt
ttggtgcaccatcttcccgcccttatatctgcgatttcccagtacggttcttccgaagga
caaggccctctccgagaggcgagatccctacatctaacaatcgccggcaataaagaatcg
gcgaactgggtactgccgaaatttcatgctgcggttgttgtgttttggctggctgaatat
tcaggttggttctttgatagtgggccggtatctccgctccagggaatcaatcctgcacat
gagttatcagctcttactcaaacattcatgtcctctctggatgctggcggcttggagttc
atactcttagtttgtgcgggggtagctggcgaagagtgggatgtcccggcgaggaatgaa
ttggtcagtttgattttaaaagatgcgcaaaggctgtctgtggagccggacagacctact
gcctattttcacgaactcttgatggttggtttggaagctttcacggaatccttgattgca
aacatgccagatgcgatccgccacctcaaatcggaagaagactcgcagcggctagatcag
atgacggcacttcgtgaaacggcaaatgcctctttgcaccgcggtttaattgaacctcga
atgcatcttgaatcgttactcgtgatcattgcattcacatttgataaaagggatgaacct
gctcaagaattctgggccgacaccgatggcaacctttacgggttcctccagtgggtatct
aaacgccaaactgttccgcgtgttagcgccttttgcgagatgctatgttcgctttctggt
ggtgaagagaattcagcctcagcacacagtttcttgcaagacgaggattcgtcatcttcc
aagttccgaagatccatctctatgaactgggaccagatgtttgccgagctgcaactgtac
gccaccagggtcactgaacggccaccagcatcccagccatcggttctacgtaaccgcaag
cctgagactgtagacattgatgaacctgaaagtccagtcatgcttacttgttacttgcgc
cttattagccatctttgcaaagaaaatacacaaattcgtgaatggatattgaagtatcca
actgctaacattgctaatactctcctcacgctctgtgccgcgccgatacctcattatttg
agagcttccattttcgttactttgcgctgtataatgttgcaacgaacaaccacccatgga
aacgagatgtggacattaatcgaccaatggatttcaggctctggggcctcacccctatca
ttaaccaagttgccagttttaacaagctctcctactttaaacgaacgccatgtctttcaa
aggattatggaaagcttcgaccagaccaatgctttcgtcgacttattgatcgtgttaacg
tctcccactgttgattccggcgactcacaaatatgcctacaattcccggaatcgctcggc
tcctcatatcaggggaaagaagctcgacttttgcaatgcaactgtctcagctttgtcgcc
attaacttagagtcattcaatgaaaatctcgtatctttggttaaccaaacaaccgtttcc
agccacacgactattggaaacgttcccctgcagacatatctccgtttgcaccccttttcc
cgcataatggaatggttatttaatgaagatgtcttgcgagcgctattcgcttgctcgcat
caagacattgaagatgtagcacaggcttcgtcggactccgtgctactccaagcccttatc
aaaagcattgatgttatgaatatgattatgtaccatcaagccacattttttaatattgtt
cggccctttgttaggagtttcccacatcaagggaaatcaaacatggcgaatacatctctt
gcgtcgttcgaagacagtgtgatggacaacttgagtttgataactgacttatgtctctac
tgcggaacgggccaccctcagctaactcttacttctctcgcccttttggaaaagttatcg
gcctctcgcaaactcaataaacccaccgctatctttcaatggcagacgcccaatcaactg
gtggagctactcaactcgaatgtggatgccgaccgtattgcccgttccctggcatctcaa
atggttcccgatatgcgcgaattggaaaacggccctacagccgctggataccttatcaaa
cttggattagtccaattactcgataaatgtctgaacatgattccgaacaaacctacgata
gcccatgttctccttggatttaggtgtatcggaaatcccttggatgtggcttcggatagt
ctttttgaaaaaggtctgtcgttactccacgccatcattgatttggtcaaggcttatcca
gatggtggtgatggaactataatatcgtggatgatacatttaaagcagctcgcgttccat
gtactgcagtgtctttggacctcgtcactctcttcggcattggttttaccacaactgcgc
gcaaatcggctccttgcgaatcttcttgcctctcaggccataatcgctccggattcgctg
tgggatgggtttcggataacagagtcagatttctggttttcagaatcagcagttggcctc
tcagaatttcttgtctatcgaagtcttcttttcgactacgcgacgactgagacaagagcc
gtctttaaagaaagctccccttcctttcaacgggacacattatcaaccttacttggaaat
tcgacatccgaagacgggacgatcatttctcacccttcgattttcgaccttttcgatttt
gccgaccttgacgttgagtgggaatatgccttcccgggtctcaaatattttagagatgtg
gatttaagtgtctgtgctgcatctcaattagatggatttccagtattatacgacctttca
agcgtggaatccttgctccaacttacgaaagacaaccttttaaactccggccaagttagc
atgcaggaagaagatcaggtttctacagagcgcgataagctactactcttcctccgtgcg
tcaaaccaaaatcgtcaaatccgatacaatcgccttgtcgccctaaaatcatgggtagaa
ttagttattacaattattgttaacggcgaaatggatcccactcgcatggcgacacttatc
ctgcacactcttcaagttatcctacccaagcttgagagctctattattgaaaatgcagca
gaggccacggagctagctcgccttgctgaaactctcatcgaaaagctcgtttcatcaaaa
ggtaacgaagacgttattgatgagcgactgcatcatcttttccatgtatgcgttcgtggt
attccctccgtattggaagaaaaggctttgagggaaaccctttatcacatttgctctagg
tatctttcacggattaccaaaaaaggcggcgccaaggtgcgtttcgggagccgcgcccat
caaatcattaaatctacaggttctagcttaattgacgccgtttgcgatgacgcgtattcc
ggggacgagaattgtcgaatatccgccttggttttcttgaaccttctctccgtcctttgc
gagcaacaatcgtcttccgttctcgtgactttaatctcccaatctaattatctcctaatg
ttccttgatgctgtcaggtctatggcgtcggaattccgaaatacccaaggtgccgagaca
tcgcaattgttagtgttctacgaagctttattgtcacttctacagcagctttcacagtca
aaaatcggagcaattcatcttctcgatgcgggtctgtttcaggccgtgaaagagtcgcag
atttttgctgctgatccagatatcggtttagacattgacaaccccgatgctctccataaa
tattttgaccttcttctttcagtacttcgcgtcattgtggctgctgtcttcacgcggggc
ctacacaacaagcaaattgttgagcaaactaggaacttcttgtccgagaaccgacagagt
atggtcggaatattcaaacgttctgccaaagttggaggttctgagcgcacagatatacaa
gattctctgcgtgaacttgtcaaattatatgtcgccttgattgctgctgtagactttcta
gactttgaggatcaatcgcagcaaccagccgtacaaaaaattattttcatagtacttttc
aacaatgaaatatag

DBGET integrated database retrieval system