KEGG   Uncinocarpus reesii: UREG_05014Help
Entry
UREG_05014        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ure  Uncinocarpus reesii
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UREG_05014
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UREG_05014
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UREG_05014
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UREG_05014
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     UREG_05014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 405 aa AA seqDB search
MVLISGAGEKAFCAGGDVATLAQQNTEGKEGQQKSKDFFSLEYQLDHLIATYSKPYIAIL
DGITMGGGVGLSVHAPFRIATEKTLFAMPETTIGFFPDVGGSFFLPRLDGEIGTYLALTS
ERLAGVQAFYSGIATHYLHSSTLSQMVSRLSELTFKDYASLAERLDVVNSTISEFSTGLP
DEPILLAGSLRESIDRCFSGSTVEEILAALEAETVNTEWAQKTIKTLKTRSPTALKVTLR
QLRVGREWSIAETFQREEKIAGHFMEHPDFVEGVSARLINRPPTEPNWKPATLEEVTTQD
VDEFFRIPQGEQRLSLLNPEADYTEYPHARFALPSEAEIEKFVRENSTSKTQIVKAFEAK
WREKEGVRAKVTEVLNRKTKSTDKGRQWIDGVEEIQESVEEEEKA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgatatcgggagctggagaaaaggccttttgcgctggaggcgacgttgccact
cttgcgcaacagaatactgaaggaaaggaaggacagcaaaagtccaaggacttcttctcc
ctcgaataccagctcgaccacctcatcgcgacatactcgaaaccgtacattgcaatattg
gatggtattacaatgggtggtggtgttgggctcagtgttcacgctcctttccggatagct
actgagaagacactcttcgctatgccagaaacgaccatcggtttcttccccgacgtcgga
ggatcttttttcttgcctcgcctcgatggagagattggcacctatcttgccttgacttca
gagagacttgccggtgtccaagccttttatagtggaatagctacccattatctccactca
agcacgctgagccagatggtgtcacgtctttcagaattgactttcaaggactatgcctca
ctcgccgagcgcctcgacgtggtcaatagcactatttcagaattctctacaggtctcccg
gacgaaccgatcttgcttgccggcagtcttcgcgagtcaattgaccgctgcttctcgggt
tctacagtcgaagaaatcctcgccgctcttgaagctgaaacggtgaacacggaatgggca
caaaagacgattaagacactgaaaactcggtcgccgacggctctcaaggttaccctacgt
caactgcgtgtcgggcgggaatggtccattgctgagaccttccagcgcgaagaaaagatt
gctggccatttcatggagcaccccgatttcgtggagggtgttagtgcgcgcctcatcaac
cggccccctacagagcccaactggaagcccgccaccctggaagaagttactactcaagac
gtggacgaatttttccgcatcccacagggagagcagcgcctctcgctcttgaatcccgag
gcagattataccgaatatccacatgcgcgattcgcactccctagcgaggcggaaattgaa
aagtttgtgcgcgagaatagcacctccaaaacacagattgtcaaggcgtttgaggcgaag
tggagagaaaaggagggtgtaagggccaaggtaactgaagtgcttaaccgaaaaacaaag
tccacagacaaaggaagacaatggatcgatggggtagaagagattcaagagagtgtcgag
gaagaggagaaggcataa

DBGET integrated database retrieval system