KEGG   Uncinocarpus reesii: UREG_05056Help
Entry
UREG_05056        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ure  Uncinocarpus reesii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    UREG_05056
Enzymes [BR:ure01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     UREG_05056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 432 aa AA seqDB search
MGFFDYLQKKGVGAIQAQKVQIRKVERKPSAVKPSSLPASKSTPSRTTLVSKATVARRST
SSASTPVRDPKPRSKSTSRKRNASEQTLCSSSDDSDTDQLLDFRLRKRAKVSASAEPDPQ
RFQLMVPRDNDGFKPLDDIVQVIEIVSQNYIPEEHVPLFDEESNGLLRRLRRALVQGSLA
NFLDGIKHYNETIKRLRLDGSISQHLDSLHMLRLPLVERILTQVYSRTVSPRVDSLRQYV
NGSDNVYGELLPRLISKIFAETRLKSDQTFVDLGSGVGNVVLQAALEIGCESWGCEVMQN
ACDLAELQEKEFKTRCRLWGLAPGKTRLIRGSFLESDSIGKILHKADVVLINNQAFTPEL
NNKLVNYFLDMKEGCQIVSLKSFVPPGHRIQARNLNSPINLLSVKEKQYWSDSVSWTNAG
GRYYIATKDSSR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcttcgattacctccagaagaaaggagtcggggcgatccaggcgcaaaaggtt
caaatccgtaaagtagagcgcaagccttcagcagtaaagccttcttccctaccggcttcg
aaatctaccccatcgcgtacaacactcgtttcgaaggctacagtcgcgcgcagatccacc
agttcagccagcactccagttcgtgatcctaaacccagatcgaagtccacctcgcgtaag
aggaacgcctctgaacagacgctatgcagcagcagtgacgatagcgataccgaccagctg
ctagattttcgattacgcaagcgggcaaaagtcagtgcgagcgctgagccggatccccaa
cgatttcagttgatggtgccccgcgataacgacggattcaagccacttgacgatattgtc
caggtgatcgaaatcgtttcccagaactatattcccgaggagcacgtgccactttttgat
gaggaatccaacggtttattacgtcggttgcgtcgcgcacttgtccagggctccttggcc
aatttccttgatggaatcaagcattacaatgaaactatcaagcggctaagattggacgga
tcgatatcccaacaccttgattccttgcacatgctgcggcttccgctggtggagagaata
ttgacacaagtttactcgcggaccgtttcccctcgtgttgactcgctacgccagtacgta
aacggaagtgataacgtttatggggaacttttgccacggcttatttcgaagattttcgct
gaaacccggctgaaatcagaccagacttttgtggatctagggtcaggagtcggaaatgtc
gtcctccaagcagctttggaaattggatgcgagagttggggctgcgaggtgatgcagaat
gcctgcgatttggcagagctccaagagaaagagttcaagactcgatgtcgtctatggggc
cttgctcctggtaaaacccggttgataagaggaagtttcctcgagtcagatagcattggg
aagattctccacaaagccgacgtggtgcttatcaacaaccaagcatttacccccgaatta
aataacaagttggttaactacttccttgacatgaaagaaggctgccagattgtgtcactc
aagtcgtttgtgcccccaggccatcggatacaagctcggaacttaaattcgccgatcaac
ctactctcagtcaaggagaagcaatattggtctgacagtgttagctggactaacgctgga
ggaagatattatatcgctacgaaggatagctcccggtga

DBGET integrated database retrieval system