KEGG   Uncinocarpus reesii: UREG_05065Help
Entry
UREG_05065        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
ure  Uncinocarpus reesii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 629 aa AA seqDB search
MNTYHRHPLSYSVQSSGGHYIHDDLGSRWMPYVSAIAYTFASSVLLYFLLIHLHVLPPIP
FSTLAWKLLVMLSPSPLVFALDKDITEGTTTKDGPVLHNSVGTAAKEEALRRIFRFSRIP
FFSQGPGQRNSSSSFPKSTVVAPPGLGNFNNSCYQNSVIQGLASLRQLSAFLNNSLESFG
HAREMSTHVSLKATIIQLNDLSNTGRRLWLPGELKSMSSWQQQDAQEYYSKVIEQIDKEI
SQASKLKAMDDGFKSGITSDQKTQAAPTGSQGCDILKRFGFVDLVGPFDNPLEGLTVQRV
GCMTCGYCEGLSLIPFTCLTVPLSQRMEYDVRDCLDDYTALEPIEGVECTKCTVLRVESG
LVEFLDKLEAQDCIQLEPSEKAQKEALRKMTESRLHAVRGVLSQEDFSEKTLLEKCRLNP
KNRVSSTKSRQSVIARAPKSLAIHINRSVFDELTGVLRKNYAKVIFPDILDLDEWCLGSK
QSKKEDDDLTENWEADPTKSMLSSPNSTFQSLNRRYELRAVITHFGRHDDGHYICYRKIS
FESPRPTSLVEHGLDGNERKNDQWFELSDADVTPVSKNHVLSQGGVFMLFYELIEGTPEE
ASEESSGISSKQSEITLETSSEMPVDIPD
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaacacataccatcgacaccctttgtcttactcggttcaaagctccggcggacactac
attcatgatgatcttggctctcgatggatgccctatgtatcggcgatagcatacactttc
gcatcttcggtcctcctgtacttcctgttgatacacctccatgtcctaccaccgattcca
ttctccacactagcttggaagctcctcgtgatgctttctccgtcgccgcttgttttcgcg
ctagataaggatataacggaaggaaccaccacaaaagatggcccagtactccacaactct
gtcggtacggcagcaaaggaagaagcgttgcggagaattttccgtttcagtcgaataccg
ttcttttcccagggccccgggcaacgaaactcgagttcttcgtttccgaagtcaacggtg
gtggcgcctccagggctagggaatttcaataactcttgctatcagaacagtgttattcag
ggattagcgtcacttcgacagcttagtgcctttttgaacaacagccttgaatcattcggg
catgcgcgggagatgtcaacgcatgtatccctgaaagccacaatcattcagctcaatgat
ctttcgaatacaggtcgcagactgtggttaccaggggaactcaagtcgatgagcagctgg
cagcaacaagacgctcaagaatactattcaaaggtcatcgagcagattgacaaagaaata
agtcaagcctcgaaattgaaagctatggacgacgggtttaagtctggtataacgtccgac
caaaagacacaggcagcgcccactggttcccaggggtgtgacattctaaaaagatttggc
tttgtggatttggtcggcccttttgataaccccctcgaaggactaactgtgcaacgggtc
gggtgtatgacttgcggttactgcgaaggactatccctgatcccttttacatgccttacg
gttccgctgtcccagcgaatggaatatgatgtacgggactgtttagacgattatactgcg
ctagagcccattgaaggggtagaatgcaccaaatgcaccgtattacgcgttgaatccggc
ctggtcgaattcttagacaaactggaagcccaagattgtattcagcttgagccgagtgaa
aaggcacagaaggaagccttgagaaaaatgacagaatctagattgcatgccgttcgaggg
gtcctttcccaggaagacttttcagaaaaaactcttcttgaaaaatgccgtctcaacccg
aagaatcgcgtttcctctacaaagtcgaggcagtctgtcattgcaagggcgcccaaatcg
ctagccatccacataaatcgaagcgtgtttgatgaattaaccggagttttgaggaagaac
tatgccaaagtcatcttcccagatattttggatttagacgaatggtgtttgggcagcaag
caaagtaagaaagaagacgatgatttgacggaaaattgggaagcagatcctaccaaatct
atgctatcatccccaaactccacgttccaatcccttaataggagatacgaattgcgggct
gttattacgcattttggacgacacgacgatgggcattatatctgttatagaaagatttca
ttcgaatctcctcgccccacatccctagttgagcatggcttggatgggaacgaacggaaa
aatgatcaatggtttgaactgagcgatgcagacgtcacgccagttagcaagaatcatgtc
ttgtcgcaaggtggagtattcatgctgttctatgagttgatagaaggcacccctgaagag
gcctccgaagagtcctccggtatctcttccaaacaatctgaaattacactggaaacctcc
tctgaaatgccggttgatatcccagattga

DBGET integrated database retrieval system