KEGG   Uncinocarpus reesii: UREG_05080Help
Entry
UREG_05080        CDS       T01132                                 

Definition
acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ure  Uncinocarpus reesii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UREG_05080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UREG_05080
   00620 Pyruvate metabolism
    UREG_05080
   00640 Propanoate metabolism
    UREG_05080
  Energy metabolism
   00680 Methane metabolism
    UREG_05080
Enzymes [BR:ure01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     UREG_05080
Lipid biosynthesis proteins [BR:ure01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   UREG_05080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 700 aa AA seqDB search
MSESPAEPKAPVVIEAHQVDTFHVPEAFHHNHPHGPHLRNMDEYNRLYQESINDPDTFWA
RMARELITFDKDFVKTHIGSFAGGDNAWFVGGRLNASYNCVDRHAMQNPDKTAIIYEADE
PDQGRYITYGELLKEVCQLAWVLKSQGVKKGDTVAIYLPMIPEAIVALLACARIGAIHSV
VFAGFSSDSLRDRVLDARSKFVITADEGKRGGKLIGTKKIVDEALKQCPDVVNCIVFKRT
GADVPWTKGRDLWWHEEVEKYPNYIPVEPMDSEDPLFLLYTSGSTGKPKGVMHTTAGYLV
GAAATCKYVFDVHRDDRFFCGGDVGWITGHTYVVYAPLLLGCATVVFESTPAYPNFSRYW
DVIEKHKVTQFYVAPTALRLLKRAGDHHINHEMKDMRVLGSVGEPIAAEVWKWYHDVIGK
RQAHVVDTYWQTETGSHVITPLAGITPTKPGSASLPFFGIDPAILDPVTGVEVHGNDVEG
ILAFKKPWPSMARTVWGDHKRYMDTYFNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVNV
SGHRLSTAEIEAALIEHHSVAEAAVVGIPDPLTGQAVHAFVALKNSNENKEQLRKELVMQ
VRKSIGPFAAPKVVFVIDDLPKTRSGKIMRRILRKILSGEEDSLGDISTLSDPSVVSKIL
DTYHEWKKVVDAAASAAATVASNTATNAAAAISAKTTTAA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagtctcccgctgaaccaaaggccccagtggttatagaggcccaccaggtcgat
actttccatgtcccggaagcattccatcacaaccatccccatggaccgcacctgaggaat
atggatgagtacaaccggctctatcaagaatccataaacgaccccgacacgttttgggcg
cgcatggcgcgcgagcttatcacatttgataaagatttcgtcaaaactcacattgggtct
tttgctgggggggataacgcatggtttgtcggtggtcgcctgaacgcttcgtacaattgt
gtcgaccgtcatgccatgcagaatccagacaagacggctataatatatgaagcagacgaa
cctgaccagggccggtatatcacctacggcgagttactgaaggaagtctgccagctggct
tgggttctgaagagtcagggtgttaagaaaggtgatactgtggcaatatatcttcctatg
attcccgaagccatcgttgcgctcctagcctgtgctcgcattggtgctattcattctgtc
gtctttgcaggtttctcttccgattccttgcgcgaccgtgttctcgatgcgcgatcaaag
ttcgttataaccgccgatgagggtaaacgtggcggaaaactcatcgggacgaagaagata
gtagacgaggcgttgaaacaatgcccagacgttgtcaactgcatcgtctttaaaagaacc
ggcgcagatgtaccctggaccaagggccgtgatttgtggtggcatgaagaagtcgaaaaa
tatccaaactatattcctgttgagccaatggattctgaggaccctcttttcctgctatat
acgtccggctcgactggaaaacccaagggggttatgcatacaacagctggctatcttgta
ggggcagccgccacttgcaaatacgtcttcgatgttcaccgtgacgaccgtttcttttgc
ggcggtgatgttggatggattacagggcatacatatgttgtctatgccccgttgcttctg
ggatgtgccactgtggtcttcgaaagcacaccagcataccctaacttttcccgttactgg
gatgttattgaaaagcataaggtgacccagttttatgtcgcaccaactgcgttgcggctt
ttgaaacgtgcgggcgaccatcatatcaatcacgaaatgaaagatatgcgcgttctgggc
tctgtaggcgaacctatcgcagctgaggtctggaagtggtaccatgatgttattggaaaa
agacaagcccacgtggttgatacatactggcaaaccgaaaccggctcccatgttatcact
cctctcgctggcatcacgccaactaagccaggaagtgcgtcgcttccattctttggtatt
gaccctgctatccttgatcccgttacgggcgtagaggtccacggaaatgatgtcgaggga
attcttgccttcaagaagccatggccaagtatggcccgcactgtgtggggtgatcataaa
cgatatatggacacttatttcaatgtctataaaggttattatttcaccggagacggcgcc
gggcgagaccatgaaggctattattggattagaggacgcgtggatgatgttgtgaacgtg
tctggtcatcgcctttcgactgcggagatcgaagctgctcttatcgaacaccactccgtt
gctgaagccgctgtcgttggtattccagacccattgacaggacaggctgtgcatgctttt
gttgccttgaagaatagtaacgagaacaaggaacaacttcgaaaagaactggtaatgcag
gttcgtaaatcgattggcccgtttgctgctccgaaggttgtgttcgtgatcgacgacctt
ccgaagacacgtagcggcaagatcatgagacggattttgcgcaagattttaagcggcgag
gaagatagcctcggcgacatctcaacgctttctgatcccagcgtggtttctaagattctt
gatacctatcatgagtggaagaaagtagttgacgccgccgcctctgctgctgccactgta
gcttccaatacggccaccaacgcagcagctgcgatctcagcgaaaacaacaaccgccgct
tga

DBGET integrated database retrieval system