KEGG   Uncinocarpus reesii: UREG_05258Help
Entry
UREG_05258        CDS       T01132                                 

Definition
protein mst2
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     UREG_05258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1061 aa AA seqDB search
MAATMLAEYQNTAVEDENMADSEQDAEGEDDVDLYHQLTASANFGGTEFAGANHMIDREV
GSEQDYTGEAAGQNVEMTGALDVNDINESNQEHEPMQTVKYLPVEYKSESDVEEGDPSFT
NDASESGRDGVSNQSSDDDSEADEDWEAESDDRDSADVEDTTQNNCIICGQDEEHDPGEE
FEEPLVCAVCGDHCHRQCAREQECFSDTDNSAKWRCASCVQNKLEEDSKDRAKSRRKSIA
SNIAKELLPAHADSLGPDSHSIFENPILDDDPLDGSRSLRKRKASIDEADNTRALSRKRR
RTTNDLTDTSQAANEEASDQVVDPSNPSTRSSRRRQARRTQNALCSVVLRQHGRLVISFH
LDHEKLNNILKARPRPRNQRRRPPPKPPAVPAEPPPPQFPPIISTPYTAPFYSFHEREDH
ELNSKPYGGILADADADTSKTVPQQADRDKFEAARQKAEEEWRQKVQVAEQNGEGTPRAT
QKLSGPPSKMKCISFGGYEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDFVAWRHKLK
CPVKHPPGDEIYREGTISVFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMT
EYDELGFHFVGYFSKEKRPKRKVGSPEKPLSDMGLVSYRNYWHLILSYQLRDQKGPTSIA
ELSERTGMTPDDVVSGLEGLRALVRDPITKTYALRLNYTYFEEVIQNWERKGYVQLNPDA
LVWTPYVMGRSNQSHYDRAPLHAVAPRDDHEEAIVDGDTIPNTYENRNGLLHVAENHGFG
TNGQTHADSIPELEPPGPPSMEVMSFGGQSMKHSNGCSTPSVSSLSNVAANIPPTRFEIF
PPVQAAVGKRRPGRPFGSYKKVRPGTAAATASPSRTSGRNTPRRNYNLALATPTPAVRAS
PGLRRGRSKLLDNVAHTDGPADEPVDDEAVLNTEELDASGPGPRGGDGRLDIDDQVDVNG
NETQNSTWDRDSPNESNGIFVGGQLPEPGLATRIKDRKDTASEPDTSNATEQLTAEILAA
ADNAVEKAAPGIYPAHGIPSPQQNGIKGEPGLTTTSASTEG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccatgctagccgagtatcaaaataccgccgtggaggacgaaaatatggcg
gatagcgagcaggatgccgaaggagaagatgatgttgatttgtaccatcagctaacggca
tctgctaattttggcggaaccgaattcgctggtgcaaaccacatgattgaccgagaagtt
ggttcagagcaggattatacaggagaagcagcgggccagaatgtcgaaatgactggtgcg
ttggatgtcaatgacataaacgaaagtaatcaagaacacgaacccatgcaaacggttaaa
tatcttcccgtggaatacaagtccgagagcgatgttgaggagggcgaccccagcttcaca
aacgatgcaagtgaaagcggccgagatggcgttagtaatcaatcctccgatgacgattca
gaagccgatgaggactgggaagccgagagtgatgacagggattcagcggacgtggaagac
acgacgcaaaataactgcattatctgcggccaagacgaggagcatgatcctggcgaagag
ttcgaagaacctttggtttgcgctgtctgtggagatcattgccatcgtcaatgcgcgcgc
gaacaggaatgtttcagcgacaccgacaattccgctaaatggcgttgtgcctcgtgtgtt
cagaacaagttagaagaggactctaaagatcgtgccaaatctcggaggaaatccatcgca
tctaacatcgccaaagaattgctccctgcccatgccgatagtctaggcccagactcgcac
tccatcttcgagaatccgatcctcgatgatgatccgcttgatggttctcgctcgttgagg
aaaaggaaggcctcgatcgacgaagcagataatacccgcgctctcagccgaaaacgacga
agaacaactaatgacctaaccgatacgtcgcaagcagcaaatgaggaagctagcgaccag
gttgtggatccatcgaatccttcaacccgctcatccaggcgtaggcaagccaggaggact
cagaatgctctctgtagtgtcgttctaagacaacacgggagattagttatttctttccac
ctggatcacgaaaagttaaacaatatattaaaagccaggccgcgccccagaaaccagaga
cggagaccgccaccaaaaccaccagctgtcccagcagaaccgcctcctccacaatttcct
cctattatttcgacaccatacacggcgcccttctactcgtttcacgaacgcgaagatcat
gaactcaactctaagccctatggtggcattttagccgatgcagacgcagatacctccaaa
acagtaccacaacaggccgatcgggacaaatttgaagccgcgaggcaaaaggccgaggaa
gagtggaggcaaaaggtacaagtagccgagcaaaatggcgaagggacaccacgagccacg
cagaaattgtctggccccccgagcaagatgaaatgcatcagcttcggtggttacgaaatc
gagacctggtatgctgctccatatcccgaagagtatagtcgcaacagagttctttacata
tgcgaattttgtctcaagtacatgaattccgattttgtggcttggaggcacaagcttaag
tgcccagtgaagcatccacccggagatgagatataccgcgaaggcaccatctccgttttt
gaagttgatggccggaaaaatcctgtttattgtcaaaacctctgtttacttgcaaaactc
ttcctcgggtcgaaaactctgtattatgatgtcgaacctttccttttctacgtgatgact
gaatacgacgagctgggtttccattttgttggttatttcagcaaggaaaagcggccaaag
cgcaaggttggctctccggagaagccactctcagacatgggcttagtttcatatcggaat
tactggcacctgattttatcgtaccaacttcgtgatcaaaaaggcccgacgagcattgct
gagctgtctgaacgcacgggaatgacgccggacgacgttgtatccggcttggaagggcta
cgtgcgctagtccgtgaccctatcaccaagacgtatgctcttcgcctaaattacacctac
tttgaagaagttattcaaaattgggaaaggaaaggctatgttcaactaaatcctgacgca
ctcgtttggacaccatatgtcatgggacgaagcaaccagtcacattacgatcgtgcgcca
ctccatgctgttgcaccccgagatgaccatgaagaggctatcgtcgatggagatacgatt
cccaatacgtacgaaaatcggaacgggctgttacatgttgcagaaaatcatggttttggt
accaacgggcaaactcacgccgattctattccggagctcgaacctccaggcccgccatcc
atggaagtcatgtcctttggtggccaatcgatgaaacacagtaacggctgcagtactcca
tcggtttcttctctctcaaatgtagccgccaacattccacccacaagattcgagattttt
ccacctgtgcaagcagccgtcggcaaacgccgcccaggacgtccatttggtagctataag
aaagttcgtcccggtacagcagcagcaaccgcatctccatcgcggaccagtggacgcaat
acgccacggaggaactataaccttgccctcgcaacgccaacacctgctgttcgcgcatcc
cctgggcttcgcagaggccgtagcaagctccttgacaatgtcgctcatactgatgggccc
gccgatgaaccggtagatgatgaagctgtgctcaacactgaagaactcgacgcaagcggt
cctgggcctcgtggaggtgatgggcggttagacattgatgatcaagtcgatgtgaatgga
aacgagacccaaaatagtacttgggatcgagacagccctaatgaatcgaatggcatattc
gttggcggccagcttccggagccaggcctcgcaactagaatcaaagacaggaaggatacg
gcttctgaacccgacacaagcaatgcgactgaacaattaacagccgagattctcgctgct
gctgataacgctgttgaaaaggccgctcctggaatttatccggctcacggcattccaagt
cctcaacagaatggcataaaaggagagccgggtttgacaacaacatcagcgtccactgaa
ggctag

DBGET integrated database retrieval system