KEGG   Uncinocarpus reesii: UREG_05278Help
Entry
UREG_05278        CDS       T01132                                 

Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ure  Uncinocarpus reesii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ure00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 617 aa AA seqDB search
MMYSVLKALCAIPLLCSVAGSAKTSFALQQEETLDQWLEAEGTFALQAILDNIGPNGAKV
RGAHAGIVVASPSKSNPDYFYTWTRDAALVFKQLVDTFIAGNYDLQDKIHEFITAQAELQ
TVSNPSGTLSTGGLGEPKFHVNQTAFTGDWGRPQHDGPPLRATAMITYAKWLVDNGHVDA
ARSIVWPVVQNDLAYVGQYWNSTGFDLWEEVKGSSFFTAIAQHRALVEGGNLARQLGVDC
SQCESQAPQVLCFLQSFWSGTNIIANFGGDRSGLDTNSILGIIHNFDPEADCDDNTFQPC
SSRALANHKRVTDSFRSIYPINSRIPSDQAVAVGRYAEDVYYGGQPWYLATFAAAEMLYN
AIYQWNRTGEMSITDVSLPFFKGVYSSAQVGKYSASSRAFSDIMANVTKYADGYLNIARR
YTPCSGALAEQFSKADGRPLSASDLTWSYAALLTAKERRNAIVPGPWGQKSAHDVPTTCS
ASPAPGRYQTATITGWPSTLTPVPTSPTPCPAPNRVKVTFQSITETKWGENIFIVGSVAE
LGSWNPEAATPLRADKYEDSCHMWYAQVDLPAGARVEYKYIRKSGDGKVVWESDPNRSYK
IPKKCGVSSLTLKSSWR
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgatgtactctgtcctcaaagcgctgtgcgccatccctctactctgcagcgtcgctggg
agcgcaaagacgagctttgcattgcaacaggaagaaaccttggaccagtggcttgaagca
gagggtacttttgccctccaggcaattctcgacaatattggacccaacggcgccaaggta
cgcggtgcccacgctggcattgtggttgcgagcccgagcaaatctaatccagattacttt
tatacatggactcgggatgccgccctcgtcttcaaacagcttgtcgacacgttcattgct
ggaaactatgacttgcaggataaaattcacgagttcattaccgcccaggcggaattacaa
accgtgtcaaacccatccgggacgctgtctactggtggtctcggagagccaaagttccat
gtcaaccagacggcgttcacgggcgactggggccggcctcaacacgatgggccaccactg
agagctaccgcaatgataacatatgcgaaatggcttgttgataatgggcatgtagacgct
gcgagatcgattgtatggccagtggtgcaaaatgatctcgcatacgttggtcaatactgg
aacagcaccgggtttgatttgtgggaagaagtcaaaggctcctctttctttacagcaatt
gcacaacatcgtgcacttgtggaaggcggcaatcttgctcgccagcttggagtggactgc
tctcagtgcgagtcccaagcgccacaggtgctttgctttttgcagtcgttttggtccggg
acaaatatcattgcgaatttcggcggagataggtcgggtcttgacacaaattccatcctt
gggattatccataatttcgatccagaggctgattgtgacgataatacctttcaaccctgc
tcgtcaagggcgcttgcaaaccataaacgagttacagactccttccgttcaatataccct
atcaactcccgtattccgagcgatcaagccgttgcagttggccgttacgccgaggatgtt
tattacggagggcagccatggtatttagcaacgttcgccgccgctgaaatgctgtataac
gctatttaccagtggaatcgcaccggcgagatgagcatcaccgatgtatcattaccattc
ttcaaaggcgtctatagctcggctcaagttggaaaatattcggcatcatccagagccttc
tcggacatcatggccaacgttacaaaatatgcagatgggtacctgaacatcgcgaggaga
tatacaccatgttcaggggcactagctgaacagttttcaaaggccgatggcaggccactc
tctgcatcagacctgacttggtcatatgctgctcttctcacagcaaaggagagacgaaat
gcaattgtaccggggccatggggtcaaaagtctgcccatgatgttccgacgacctgctca
gcgagcccagcccccggacgctaccaaactgcgactatcacagggtggccatcgacgctg
actcccgtcccaactagtccaacgccatgcccagccccgaatcgagtcaaagtcactttt
cagtcaataaccgagacaaagtggggtgaaaacatctttatcgtcggatccgttgctgaa
ctgggctcgtggaaccccgaggcggcaacgcctctgagggcggacaagtacgaggattct
tgtcatatgtggtacgcgcaagttgatttgcctgccggagcaagggtcgagtataaatac
atccgcaaaagtggtgatggaaaagtggtgtgggagagtgatccgaatcgatcgtataag
atcccgaagaaatgtggtgtttcttcgctgactttgaagagcagctggcgttga

DBGET integrated database retrieval system