KEGG   Uncinocarpus reesii: UREG_05278Help
Entry
UREG_05278        CDS       T01132                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ure  Uncinocarpus reesii
Pathway
ure00500  Starch and sucrose metabolism
ure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UREG_05278
Enzymes [BR:ure01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     UREG_05278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 8442136
NCBI-ProteinID: XP_002584589
UniProt: C4JS39
AA seq 617 aa AA seqDB search
MMYSVLKALCAIPLLCSVAGSAKTSFALQQEETLDQWLEAEGTFALQAILDNIGPNGAKV
RGAHAGIVVASPSKSNPDYFYTWTRDAALVFKQLVDTFIAGNYDLQDKIHEFITAQAELQ
TVSNPSGTLSTGGLGEPKFHVNQTAFTGDWGRPQHDGPPLRATAMITYAKWLVDNGHVDA
ARSIVWPVVQNDLAYVGQYWNSTGFDLWEEVKGSSFFTAIAQHRALVEGGNLARQLGVDC
SQCESQAPQVLCFLQSFWSGTNIIANFGGDRSGLDTNSILGIIHNFDPEADCDDNTFQPC
SSRALANHKRVTDSFRSIYPINSRIPSDQAVAVGRYAEDVYYGGQPWYLATFAAAEMLYN
AIYQWNRTGEMSITDVSLPFFKGVYSSAQVGKYSASSRAFSDIMANVTKYADGYLNIARR
YTPCSGALAEQFSKADGRPLSASDLTWSYAALLTAKERRNAIVPGPWGQKSAHDVPTTCS
ASPAPGRYQTATITGWPSTLTPVPTSPTPCPAPNRVKVTFQSITETKWGENIFIVGSVAE
LGSWNPEAATPLRADKYEDSCHMWYAQVDLPAGARVEYKYIRKSGDGKVVWESDPNRSYK
IPKKCGVSSLTLKSSWR
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgatgtactctgtcctcaaagcgctgtgcgccatccctctactctgcagcgtcgctggg
agcgcaaagacgagctttgcattgcaacaggaagaaaccttggaccagtggcttgaagca
gagggtacttttgccctccaggcaattctcgacaatattggacccaacggcgccaaggta
cgcggtgcccacgctggcattgtggttgcgagcccgagcaaatctaatccagattacttt
tatacatggactcgggatgccgccctcgtcttcaaacagcttgtcgacacgttcattgct
ggaaactatgacttgcaggataaaattcacgagttcattaccgcccaggcggaattacaa
accgtgtcaaacccatccgggacgctgtctactggtggtctcggagagccaaagttccat
gtcaaccagacggcgttcacgggcgactggggccggcctcaacacgatgggccaccactg
agagctaccgcaatgataacatatgcgaaatggcttgttgataatgggcatgtagacgct
gcgagatcgattgtatggccagtggtgcaaaatgatctcgcatacgttggtcaatactgg
aacagcaccgggtttgatttgtgggaagaagtcaaaggctcctctttctttacagcaatt
gcacaacatcgtgcacttgtggaaggcggcaatcttgctcgccagcttggagtggactgc
tctcagtgcgagtcccaagcgccacaggtgctttgctttttgcagtcgttttggtccggg
acaaatatcattgcgaatttcggcggagataggtcgggtcttgacacaaattccatcctt
gggattatccataatttcgatccagaggctgattgtgacgataatacctttcaaccctgc
tcgtcaagggcgcttgcaaaccataaacgagttacagactccttccgttcaatataccct
atcaactcccgtattccgagcgatcaagccgttgcagttggccgttacgccgaggatgtt
tattacggagggcagccatggtatttagcaacgttcgccgccgctgaaatgctgtataac
gctatttaccagtggaatcgcaccggcgagatgagcatcaccgatgtatcattaccattc
ttcaaaggcgtctatagctcggctcaagttggaaaatattcggcatcatccagagccttc
tcggacatcatggccaacgttacaaaatatgcagatgggtacctgaacatcgcgaggaga
tatacaccatgttcaggggcactagctgaacagttttcaaaggccgatggcaggccactc
tctgcatcagacctgacttggtcatatgctgctcttctcacagcaaaggagagacgaaat
gcaattgtaccggggccatggggtcaaaagtctgcccatgatgttccgacgacctgctca
gcgagcccagcccccggacgctaccaaactgcgactatcacagggtggccatcgacgctg
actcccgtcccaactagtccaacgccatgcccagccccgaatcgagtcaaagtcactttt
cagtcaataaccgagacaaagtggggtgaaaacatctttatcgtcggatccgttgctgaa
ctgggctcgtggaaccccgaggcggcaacgcctctgagggcggacaagtacgaggattct
tgtcatatgtggtacgcgcaagttgatttgcctgccggagcaagggtcgagtataaatac
atccgcaaaagtggtgatggaaaagtggtgtgggagagtgatccgaatcgatcgtataag
atcccgaagaaatgtggtgtttcttcgctgactttgaagagcagctggcgttga

DBGET integrated database retrieval system