KEGG   Uncinocarpus reesii: UREG_05304Help
Entry
UREG_05304        CDS       T01132                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ure  Uncinocarpus reesii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    UREG_05304
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     UREG_05304
Exosome [BR:ure04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UREG_05304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 559 aa AA seqDB search
MGDLGMTEATAIPVFNQVGRDIDCSKASQPAPARGPFLADTTKPQRRFVGAIDQGTTSTR
FIIFDNKGTLVASYQTELRRLHKYPGWHEQDPREIVSSVESCIAQAKKTFVNLGHSVSDI
QALGITNQRETTVVWDWETGEPLHSAIAWPDTRTTSLVRELKAKEGADQLQEKCGLPLST
YPSSVKLAWLLRNSKEVKEAYDAGRLAFGTVDTWLLYNLNGGKKKNVFVTDITNASRTMF
ANLHTLQYDDWLLKFFDLDKSKLKLPKIVPSSDASAFGSLADGPLQGIRITSCLGDQSAS
LVGHGALTPGRAKNTYGTGCFLLYNVGETPVISKHGLLATVAFQLSADQKPVYALEGSVA
VAGSGVSFLMNNLDFFRDSRKVDEEAATVPDNGGCIFVTAFSGLFAPYWVDDAKGTIFGI
THHTQKGHITRATLEAVCFQTKAILEAMERDSGQKLSDLAVDGGLSNSDICMQSQANIIR
IPVERPPMSEVTALGAAIAAGLAVGVWRDLDELEGMNKSNRTVFEAQITEAESARMYRQW
SKAVKMSQGWLETEEINAI
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacttgggaatgactgaagccactgcaatccccgtttttaatcaggtcggccgt
gacatcgactgctctaaagctagccagccggccccggcccgcgggcctttcttagccgat
accacaaagcctcaacgtcggtttgttggtgctatcgatcagggaacaactagcacgcga
ttcattatatttgacaataaaggcaccctcgttgcttcgtatcagacagagctgagacgc
ttgcataaataccccgggtggcatgagcaggacccaagagagattgtttcatccgtcgag
tcttgtatagcccaggcaaagaaaacatttgtgaacctgggccactcagtctccgatatc
caagccttgggcatcaccaaccagcgcgaaacaacagtcgtatgggattgggagactggg
gaacccctccatagcgcaattgcatggcccgatacccgcaccacttcgttggttcgggag
ttgaaggcaaaagaaggtgccgaccagcttcaagaaaaatgtggtctgcctctatccacg
tatccatcctccgtaaaactggcttggcttctccgaaattcgaaggaggtcaaagaagcg
tatgacgcgggccgacttgcctttgggaccgtcgatacttggctgctgtacaacctcaac
ggcggcaagaagaagaatgtcttcgttactgatatcacgaatgcatcaaggaccatgttt
gccaacctgcatacacttcaatatgatgattggttgctcaaattcttcgatctcgataag
tccaaattgaaacttccgaagatcgtcccatcttcagatgcctctgcttttggatcctta
gcagacgggcccctccaagggatccggataaccagctgccttggtgatcaatcggcttcg
ttggtgggccatggtgcattgactccaggcagagcaaaaaacacctatggaacgggatgt
tttctgctgtataatgtaggtgaaacgcccgtgatctcgaaacatgggctcctggcaact
gtcgctttccaattgagcgccgaccaaaagccagtatatgcgttggagggaagcgtcgcc
gttgctggcagcggcgtctcgttcttgatgaacaacctggatttcttccgtgactcgaga
aaggtcgacgaggaagcagccaccgtaccagataatggcggctgtatctttgtcaccgcc
ttcagtggcctcttcgcgccgtattgggttgatgacgcaaaaggaacaatatttgggata
acacatcacactcagaaaggccatataacccgggcaacacttgaagccgtttgtttccaa
acaaaagccatcctggaggctatggaacgcgacagtggccagaagctttctgacttggcg
gttgatggaggactgagtaactcggacatctgcatgcagtcccaagcaaatataatccgt
atccctgtcgaacggccgcccatgagcgaggtcaccgcattaggcgcagccattgcagca
gggcttgccgttggcgtgtggcgtgacctcgacgagctagaggggatgaataaatcaaac
aggaccgtattcgaagcgcaaatcaccgaggcagagagcgccagaatgtaccgccagtgg
tcgaaagccgtcaagatgtctcaggggtggcttgagactgaagaaatcaatgcaatctga

DBGET integrated database retrieval system