KEGG   Uncinocarpus reesii: UREG_05419Help
Entry
UREG_05419        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ure  Uncinocarpus reesii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 412 aa AA seqDB search
MAETTSDLAPEFGCVADCRSGSIWCQSCEDFIYDTEVDRVLRDTSKDLQRKDLLSKKRSM
SEALAYADAEEASYLASNSNKRICGKDGMRGLYNLGQTCYMNVILQTLFHEPLLTTYFLG
HRHRMYDCSESNCFVCQVAEVFAEFHEEKEEGFGVLNFLLSSWLSSPDLAGYQQQDAHEF
YQFLVNKLHATAEDHVDGYEQKCRCFFHKAFFGKLQSSVTCHRCRNTNRTEDPIMDLSLA
FQVQRKKKALHWIPGDSESTPSLNGCLDSYTAPEELPASDYNCSWCGTPQGATKQLRLRK
LPVILCMQLKRFERHRSVSEKVDTKVAFPFSINMAPYTTSANSKNIFKYTYDLLSVVVHI
GDIDSGHYLAYCRQGEQWFKFNDDRVTWATDAEVLDADAYLLFYTLRSLSGS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaactactagtgacctggcgccggaattcggctgcgttgctgattgccgaagc
gggtcaatatggtgtcaaagttgcgaagattttatatacgacactgaggttgatagagtt
ttgcgtgatacgtctaaggacttacagcgcaaggatttactttcgaaaaagcgctcgatg
agtgaggctctagcctacgccgatgcagaggaagcatcatatttggcatcgaacagcaac
aaacggatttgcggaaaggatggcatgagaggcttgtataacctcggccagacatgctac
atgaatgtcattctgcagactttgttccatgagccgttactgacaacgtattttcttggt
catcgtcatcgcatgtacgattgctcagaatcaaactgtttcgtgtgtcaggtcgcagag
gtttttgcggaatttcatgaagagaaggaggagggtttcggcgtcctcaactttctgtta
agttcatggctatcatcgcctgaccttgctggataccagcagcaagatgcccacgaattc
tatcaatttctcgtcaacaaactccatgccacagccgaagaccacgttgacggatacgag
cagaaatgccgatgttttttccacaaggctttctttgggaagctccagagcagcgtgacc
tgccaccgttgcagaaacactaatcgcaccgaagatccaatcatggatttgagtcttgct
tttcaggtccagagaaagaagaaagcattgcactggattccgggcgactcagaaagcaca
ccaagccttaacggctgcttggatagctatacagctcccgaggaattacctgctagcgat
tataactgcagttggtgcggaacgccgcaaggggcgacaaagcaacttaggctacgcaaa
ctacctgtgatattatgtatgcagcttaagaggttcgaacgacatcggtccgtctccgaa
aaagtcgataccaaagttgctttcccgttctccataaacatggcgccatacaccacgagt
gccaattcgaagaatatctttaagtatacttatgatttattaagcgtggtggtccacatt
ggcgatattgattcgggtcattatcttgcctattgcaggcagggagagcagtggtttaaa
ttcaacgatgaccgagttacctgggccactgatgcggaggtgctggatgccgacgcatat
ttgctgttttacactttacgctccctttcaggttcttga

DBGET integrated database retrieval system