KEGG   Uncinocarpus reesii: UREG_05514Help
Entry
UREG_05514        CDS       T01132                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ure  Uncinocarpus reesii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ure00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MVQEMEDIHGMATLCCRAPVGDLSHEGLTGRGALPSDSYHLCLETPRQLESTLNGDGDRI
RKLAKAVRTILECVGEDPEREGLRTTPERYAKAMLYFTKGYAEDVQSLVNGAIFHENYDG
LVIVRDIDVFSLCEHHVVPFTGKMHIGYIPDGRILGLSKVARLAEIFSRRLQIQERLTKQ
VAMTIFDVLNPKGVGVIMESSHLCMAMRGVEKVGTATTTSYMVGCMRSSAETRDEFLSLL
RRG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggttcaggagatggaagatattcatgggatggcgactctatgctgccgagctcccgtc
ggcgacctgtctcacgaaggtttgactgggcgaggggcacttccatctgactcttatcac
ctatgcctcgaaacaccacggcagttggagtcaacactgaatggagatggagaccggatt
cggaagcttgcgaaggctgtacgcacaatccttgaatgtgttggggaagatcctgaacga
gaaggcctacgtacgacaccagagagatatgccaaagccatgttatatttcaccaaaggc
tatgcggaggatgttcaaagcctggtcaatggagccatcttccacgagaactacgacgga
ctcgttattgtgagagatattgatgtcttctctctttgcgaacatcacgtggttcccttt
actggaaagatgcacatagggtacatcccagacggccgtatattgggcctctccaaagtg
gcccgtttggctgagatattctctcgcagactccagattcaagaacgcctgacgaaacag
gttgccatgaccatttttgacgtgcttaaccccaagggtgttggggtaatcatggaatcc
tcccatctttgtatggccatgcgtggcgtagagaaggttggaactgctacaactaccagc
tacatggttgggtgcatgcggtcgagcgccgaaaccagagacgaattcttatcgctcctg
cgtcgaggatag

DBGET integrated database retrieval system