KEGG   Uncinocarpus reesii: UREG_05516Help
Entry
UREG_05516        CDS       T01132                                 

Definition
WD-repeat protein mip1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ure  Uncinocarpus reesii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1357 aa AA seqDB search
MRDPKSDTYQDAQTRPQTAEQMQSVPQSKAARVSFEPQVEMYDAPTLDLRPSSTGHHRSQ
TVTFKGNGHIDVSNGASGTATSVSGYSSARIAEPVAKSMRPTPTLVRAKSDHWLKHEQDD
AAKDDDEDFELRHGWQEEYTSSEYLKILNSNFYMYFNEKRHDTGGIPKEQTGTWMQQDWR
MRDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSSGGAQNKVMEQIGKKLQE
QYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTASGEIWVFN
KTYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGHIVTNFHKFVEKHEKENAEACRKDPNAV
VQNYSDCILLAACDKTESLPTNPDLPADLFTCCLTTPIQIALRYFMLQNPLQCGFPPDEI
KIPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNFLLSERI
MRAHECRPISSPELPETHTHPLWQSWDLAVEMVLSQLPALLENEEGKRHYEYQHSSFFSE
QLTAFEVYLSSGPTESNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVHLALSIG
IFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQHDLLKDNGIHYFINILNPNTGIPVG
NVSEHRAMCAFIVAVFCKDYLQGQNVCLSPELIEFCLYHLMDVENPLLRQWCCLCLSMLW
YNFAEAKWVGIRCSAPARLCELAMDPVPEVRAAMLHALTNFIGIPDLTDQVAQIEEYLAA
SIVPMGNDGSVVVRKELLVFLSTFVKRYQNKFLVAAYEQLLEEKHILRHTVSGSKDTQPP
PYRERGVSHNTIYGSLWKLLLILSVDPQEEVAQEAGVVVDYVYKVLLDSPMGGLAQDARD
EILALHRRSQSKKPQPLELVEMKRARPETPPAQASGKSEGYFSLSLRRTASVAASLKNLA
FGSSAADQRPASPLNPSGKPTISKNRVTITPRGRAPPEWTRPPEVNDQPVSTGQYGQAPT
PPSRGFKPRDLTKEPSIPLKSRFLSWSTEYFREPQMKPNEPDEPGSADYNQRLWRRARNE
KIIVETQQMKDKGGSGRWDVASSLMNNPSQPAKMCFHQFEDHLAVADDRDTICIWDWQNN
SRLSRFSNGNPLGSRINEVRFINEDDQALLMTGSSDGVLKIFRNYESNRKAELVTSFRAL
PELIPSNKNAGLVMDWQQGQGKALVAGDVKVIRVWNAATEVCTVRAGVRELISGSRNGEI
KLWDLRMDHSIDTIQATKDTLRTLSVHEHAPVFSIGTNRHEVKTFNADGQYLSSFEPHGS
FLHHSRTSPVVGTAFHPHRMVMACSTLYDNYINLVSC
NT seq 4074 nt NT seq  +upstreamnt  +downstreamnt
atgcgagacccaaagtcggacacgtatcaagacgcacaaactcgaccgcagaccgccgaa
caaatgcagtccgtgccgcagagtaaagctgcacgcgtcagcttcgaaccacaagtcgag
atgtacgatgctccgacactagatctccgtccttcgtcaacgggccatcatcggtctcag
actgtgactttcaaaggaaacggccatatcgatgtttcaaatggggcttctgggacggca
acgtcggtatcagggtattcgtctgcacgaatagctgagcctgtagccaagagtatgcga
ccgactcctacgcttgtccgggcgaaaagcgaccattggttgaagcatgagcaagatgac
gccgcaaaggacgacgacgaggattttgagctgaggcatggttggcaggaggagtacacg
tcgagcgaatatctgaagatattaaattccaatttttatatgtatttcaatgaaaagcgc
cacgataccggaggaataccgaaggaacagaccggaacctggatgcaacaggattggcgc
atgagggatcgcttgaaaacggtatccgcagcgctcgccatttgtctgaacatcggcgtt
gatcctccagacgttgttaagacgaaccccagcgcgaaactagagtgttgggtggacccg
acttcgtcaggcggtgcgcaaaacaaagtgatggaacagatcggcaagaaactgcaagag
caatatgagaccttgagcctacgaactcgatacaaacaatatttggatccttcggtggac
gaaacaaagaaattttgcatatcgcttcggcggaacgcgaaggacgagagagtactattc
cattataacggacatggcgttccccttccgactgcgtcaggcgaaatatgggtgttcaac
aaaacatacacacagtatattcccgtgtccttgtatgatctgcagtcttggcttgcaggg
cctagcctatttgttttcgatgtttctcatgctggtcacattgtcacgaattttcataaa
ttcgtagaaaaacatgaaaaggagaacgcggaagcgtgtaggaaggacccgaatgccgtt
gtccagaattacagtgactgtatccttcttgctgcctgcgataagacagaatccctccct
acaaatcccgacttaccggccgacctctttacttgctgcttaacgacccctatccagatc
gctctcagatatttcatgcttcaaaatcctttgcagtgcggattccctccggatgagatc
aagattcccggacgccttcaggatcgtcgaagcccgcttggagaacttaactggattttc
acagccattaccgacacaattgcttggaatactctaccacgagctctattcaaaaagctt
ttccgtcaagacctcatggtcgcagccttgtttcgaaatttcttgcttagtgaaaggatc
atgcgagctcatgagtgccgtccgatatcctcgcccgaactacctgaaacacacacacat
cccctttggcagagctgggaccttgctgttgaaatggttctttcacagctcccggctcta
ctggagaacgaggaagggaaacggcattacgagtaccagcattcaagtttcttttctgag
caactcacggcttttgaagtctatttgtcgtcaggaccaactgagagcaacccgccggat
cagctaccaattgtcctacaggtgttattgagtcaagcacaccgattgcgtgcgttgatc
cttctgagtaaattccttgatcttggtccctgggcagttcatctagcactaagcatcggt
atctttccctatgtggtgaaactattgcaaagtgctgcccaagaactcaagccagtgatg
gtctttatatgggccagaattatggctgttgaccatacagttcaacacgatttgctcaaa
gacaacggcatccattatttcatcaatattcttaatcctaataccggaatccccgtgggt
aatgtcagcgaacatcgtgcaatgtgcgcgtttatcgtcgctgtattttgcaaggactat
ctccaggggcaaaacgtgtgcctctcgcctgagcttattgaattttgcctctatcacttg
atggacgtcgaaaatccactccttcggcaatggtgctgtctttgcctaagcatgctttgg
tacaattttgctgaagcaaagtgggtgggaattcggtgttccgctccagcaaggctctgt
gaacttgctatggaccctgttccagaggtgcgggcggcgatgcttcatgccctaacgaac
ttcattggaattcccgacctcacggatcaagtggctcagattgaagagtaccttgcagca
agtattgtgccgatggggaatgatggaagtgtcgtggttagaaaagagcttttggttttc
ttatcgacttttgtgaagagatatcagaataagttcttagtggccgcctacgagcagctt
ctggaagagaaacatatactcagacacacggtatcgggctccaaggacacccaaccacca
ccttatcgcgaacgtggcgtttctcacaatacgatttacggatctctttggaaattgctg
cttatactctctgtcgacccacaggaggaagtagcgcaagaagcaggtgtagtcgtcgac
tacgtgtacaaagtccttcttgattcgcctatgggtggtttagctcaagatgctcgtgac
gagatccttgctctccacagacgctcccagtccaaaaagccgcagcctcttgagctagtt
gagatgaagcgtgctagaccagaaactcctccggctcaagcatccggtaaatcagaagga
tatttttcgttgagtctaaggagaacagcaagtgttgctgcatctttgaaaaaccttgcg
ttcggatcttccgctgctgaccagcgccctgcctcgcctcttaacccatccggtaaaccg
acgataagcaagaaccgagtgaccattactccacgcggccgtgcccctcctgaatggact
cgacctccggaagtgaatgatcaaccagtctccactggtcagtatggtcaagcacctact
ccaccctcaaggggtttcaagcctagggacttgacaaaagagccttcaatccctctaaag
agcaggtttctaagttggtcaaccgagtatttccgcgaacctcaaatgaaaccgaatgaa
ccagacgaacccggcagtgctgactataaccaacgtctgtggcggcgcgctagaaacgag
aaaattatcgttgaaacccaacaaatgaaagacaaaggtggaagcggccgatgggatgtg
gcatcatccctgatgaataaccccagtcagccagctaagatgtgttttcatcagtttgag
gaccatctcgcggttgctgatgaccgggatactatctgtatatgggattggcaaaataat
tcccggcttagtcggttctccaacgggaatccattgggctctaggatcaatgaagttcgg
tttatcaatgaagacgaccaggctctcttgatgactggctcttccgacggagttttgaaa
attttccgtaactacgagtctaatcgaaaggctgaattagtcactagtttccgtgcgcta
cctgagctaatcccgagcaacaagaatgctggtcttgttatggactggcaacagggacaa
ggcaaggcacttgtcgccggggatgtgaaagtcattcgggtttggaacgcagccactgag
gtgtgcacggttagggcgggagtaagagaacttatatctggcagccgcaacggcgaaatt
aaactatgggatttgagaatggaccattccatcgatactatacaagccacaaaggacacg
ctacgaacccttagtgtgcatgaacatgcgcctgttttctctattggaaccaatcgccat
gaagtcaaaaccttcaacgccgacggacaatacctctcctccttcgagcctcacggcagc
ttcttacaccacagtcgcacatctcctgtcgtcggtaccgcctttcatccacatagaatg
gtcatggcttgttcaactctctacgataattatatcaatcttgtttcatgctga

DBGET integrated database retrieval system