KEGG   Uncinocarpus reesii: UREG_05561Help
Entry
UREG_05561        CDS       T01132                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ure  Uncinocarpus reesii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UREG_05561
Enzymes [BR:ure01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     UREG_05561
Peptidases [BR:ure01002]
 Cysteine Peptidases
  Family C44
   UREG_05561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 584 aa AA seqDB search
MCGIFACHCHPDVQKFKPTALRMAKAVRHRGPDWSGNFIANDTILAHERLSIVGVESGAQ
PLVNDDGTLALAVNGEIYNHRVLRKGLKTKYNFKTHSDCEVIIPLSKLEPLLIRFGLPQY
MEHDIDAPKFLDGMFSWVLFDKKQNRVIAARDPIGITSFYQGWSSQTPGAVYFASELKSL
HPVCDKIIAFPPGHVYDSKTDSMTRYYQPKWWDPTNVPSAPLDYKLIRESLVRSVRKRLM
AEVPYGVLLSGGLDSSLVASIAQRETQKMMAAQNGTVTNAETGAGLVGIDDSNELSTVTS
FPQLHSFSIGLPGAPDTKAAIEVANFLGTKHYAFTFTVEDGLNALSDVIYHLETYDVTTI
RASTPMYLLSRKIKAMGVKMVLSGEGSDEIFGGYLYFHAAPDKKAFHEETVRRVKNLHLA
DCLRANKSTSAWGLEARVPFLDKEFLEVSMGVDPQEKMITKERIEKYILRKAFDTSDEPG
TKPFLPDNILWRQKEQFSDGVGYSWIDALKDNAERQVTDEMMKNPKAEWGDDIPDTKEAY
WYRTMFDEHFPPSCASTVMRWTPTWSKQTDPSGRYEALNALEVL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatatttgcctgtcattgtcatcccgatgttcaaaagttcaagccgacggct
ttgcgcatggcaaaagccgtccggcatcgcggtcccgactggagtggtaacttcattgcc
aacgacacaattcttgcacatgaaagattgagtattgtcggtgtcgagtccggtgcgcag
cctctcgttaacgatgacgggacgttggcccttgccgtcaatggcgagatctataaccac
agagtcctgagaaagggattgaagaccaagtacaactttaaaacgcactccgactgcgaa
gtgatcatcccacttagtaagctcgaaccgttgctaattcggtttggtttgccgcagtat
atggaacacgatattgacgctccgaaatttctcgatgggatgttctcatgggtcctcttc
gacaaaaagcagaaccgggtgattgctgcccgagatccgattggcattaccagtttctac
caaggatggtcctcccagacaccgggcgcggtctattttgcctctgaactgaagtcactt
catccggtttgcgacaaaatcattgctttcccccctggccatgtctatgattccaagacg
gacagcatgactcgctattaccagccaaagtggtgggaccctaccaatgttccgtcagct
ccccttgattataagttgattcgggaatccttggtacgatccgttcgcaaacgattaatg
gccgaagtcccttacggtgtcctactttctggtggtttggactctagtctggtcgcctca
atcgcccagcgagaaactcagaagatgatggcagcgcagaacggcacagttaccaatgca
gaaacaggtgcaggtctggttggaattgatgacagcaacgagctatccaccgtaacgtcc
tttcctcagctgcattccttttcgattggcctcccaggagcgcccgacaccaaggctgca
attgaagttgccaacttccttggaacaaagcactatgctttcacattcactgttgaggat
ggtctcaatgctctttcagacgttatctatcacttggaaacttacgatgtgaccactatc
cgcgcatccacgcccatgtacttgttgagcaggaagatcaaggcaatgggcgtcaagatg
gtcctcagtggtgaaggtagtgacgaaattttcggcggctacctttatttccatgccgct
ccggataagaaggccttccacgaggagaccgtcagacgagtcaagaatcttcacttggcg
gactgcttgagagccaacaaatcgacctctgcgtggggccttgaggctcgggtgccgttt
ttggataaggaattcctggaggtgtccatgggtgttgatccacaagagaagatgatcacc
aaagagaggattgaaaagtatatcctgagaaaagcgtttgacacatctgacgagccaggg
accaagcctttcttgccagataacattctgtggcggcagaaggaacaattcagcgatggt
gtcggctattcatggattgatgcgctgaaagacaatgctgagcgtcaagtcacggatgag
atgatgaagaacccgaaagccgaatggggtgatgatattcccgataccaaagaagcatac
tggtaccgaacgatgttcgatgaacacttccctccaagctgcgcatccaccgtcatgcgg
tggacacccacatggtcgaaacaaaccgacccgagtggacggtacgaagccttgaatgct
cttgaagtcctttaa

DBGET integrated database retrieval system