KEGG   Uncinocarpus reesii: UREG_05623Help
Entry
UREG_05623        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ure  Uncinocarpus reesii
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    UREG_05623
Enzymes [BR:ure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     UREG_05623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 443 aa AA seqDB search
MAKPLRSHRNSGTEVETRVSAPERKSIRKDASLREWLLSNQIGISLTILTMIFAVHNLYP
SLKPYTVPFLSLPHYQPENGLYVQGSDDVYFISSSVVALVAIRAILIDWIFQPLARYMGM
KPKTSLRFAEQGWLLVYYTVFWSYGLYIWTQSKYWMDFREIWTDWPSREVPGYFKLYCLL
QLSFCLQQIFVINVEERRKDYYQMLTHHIVTSTLLGGAYVYSFYNVANVVLSIMDIVDIL
LPAAKMLKYAAFEQLCTIAFAVFLGTWFISRHVIYNLLWWSIYQNVPEVMPFGCYSGATG
QRLVDVMPNSWGSLLYPFRDIKGPICMSFRIKWVFLSFLFFLQVLSLLWFGMILRVAINV
LRAGSSAEDTRSDDEGEEPSENGNAPNGQEYHNENGWSKSVMANGSSQNHYPVRIRTARG
RVTLSDHNDRKALLGRIGCDKPS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccgctgcgtagccatcgcaattcaggtacagaagtcgagactcgcgtttca
gcgccggagaggaaatctatcagaaaggatgcctcgctgcgagaatggctgctcagcaat
cagatcggaatctcccttaccatccttaccatgatattcgccgtccacaacctttacccc
tcgctcaagccatatacagttcctttcttatctctaccccattaccaaccagaaaacgga
ctctatgttcagggatcagacgatgtatactttataagtagctcggtggtggctcttgtc
gcgattcgagcgatattgattgactggattttccagcctcttgcgcggtatatggggatg
aagccgaaaacatcattgagatttgcggaacaaggatggttacttgtatactacactgta
ttctggtcatatggattgtacatctggacccagtcaaagtactggatggattttcgggaa
atttggactgattggccatcgagagaagtacccggctatttcaagctctattgcttgttg
cagttgtccttctgtttacaacaaatcttcgttatcaacgttgaagaaaggagaaaggat
tactatcaaatgttgacacaccatatcgtcacaagcacccttctcggaggtgcctatgtc
tacagcttctacaacgtggccaatgttgtcctctctattatggacatagtggacatttta
ttaccggctgcgaaaatgttaaaatatgcggctttcgagcaactttgcaccatcgcattt
gctgtcttcctaggcacatggttcatttctcgccacgtgatttataatctgttatggtgg
tccatttaccaaaatgtcccggaggtcatgccctttggatgctactcaggtgccactggt
cagaggcttgttgatgtaatgcccaattcctggggttcacttctatacccgttccgagat
atcaaagggcccatttgcatgagcttccgcataaaatgggtgtttcttagctttcttttc
tttctccaagttctttctctactttggtttggcatgatccttcgcgtcgcaattaatgtc
ctccgagcaggttcatccgcagaagacacccggagtgatgacgaaggagaggaaccctca
gagaacggaaacgccccgaatgggcaagaatatcacaatgagaatggctggagtaaatcc
gtcatggctaatggttcgtctcaaaaccactatcctgttcgaatcagaaccgcacgcggc
cgggtcacgctcagcgaccataatgacagaaaagccctccttggccggatcggatgtgac
aaaccttcttaa

DBGET integrated database retrieval system