KEGG   Uncinocarpus reesii: UREG_05674Help
Entry
UREG_05674        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UREG_05674
Peptidases [BR:ure01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UREG_05674
Exosome [BR:ure04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UREG_05674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 703 aa AA seqDB search
MSKLAITPVTEEDRYHTTTKVVCYECQIDDIDISSSSRLEKVVDGVMNALTFSRKEEVKA
WELELTSCEHTLCLTQEGSDLERVAQLSHCSQCTMQENLWLCLQCGNIGCGRNQFGGMGG
NSHALTHAQDMNHSVSVKLNSITPEGSADIFCYVCNEERVDPNITDHLAHWGIIIADQKK
TEKSLTEMQIEHNLSWEFTMTSNDGMDLKPIFGPGLTGLRNLGNSCYLASALQCLFSLPE
FGCRYFKPTEQPPAVPLPAEDLETQLRKLADGLMSGRYSVPDSDAVAHTSSKDLPYQTGL
SPGMLKHLIGRGHDEFSTMRQQDAFELLLHLFKLINLSKHSDLLNPVTSFRFALEQRLQC
LSCGKVRYKVDEQDNISISVPVRRLSEKDNVGSQTSETKPTQSNFQRVTIRECLDIFTAE
EVVELTCSGCGSKDGFRKRSLFKTVPQNLLVNARRFELVNWVPTKLDIPVEVSDEPLDFG
QYLSSGPQEGEILLEDAPSPKKIDFQPNAEAVNMLHSMGFPEVRIKKALYATGNVDVDAA
LNWLFAHMDDPDIDAPGIFAEPENEDKQDSKADEAKVDQLFDMGIDRSKARKALLETSGD
INRALDWALNHQDDPELEEIELDGKPTPELPGSTDTPALYRLHSLICHKGASVHTGHYVA
FVHKQLPNQTHHSWVLFNDEKVVQGGDIEEMKQFAYIYFLRKL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagttggccatcacaccagtgactgaagaagatcgttatcacactaccacgaaa
gtagtatgctatgaatgccagattgatgatattgatatctcctcttcctcaagactcgaa
aaggtggttgatggagtgatgaatgcgctcactttctctcgcaaggaagaagtcaaggca
tgggagctcgagctcacttcctgcgagcataccttatgcctcacccaagagggtagtgat
ttggaacgagttgcacaactgtcccactgctctcaatgcactatgcaagaaaatctctgg
ctttgcttacaatgcggaaatattggctgtggccgtaatcagtttggaggcatgggaggt
aattctcatgcgctcacgcacgcccaggacatgaatcattctgtctcggtgaaattgaac
tctatcaccccggaggggtccgcggatatattttgctatgtttgcaacgaagaaagagtc
gatccgaatattactgatcatttggcacattggggaattatcattgcagaccaaaagaaa
accgaaaagagcctaactgaaatgcaaatcgagcacaacctaagctgggagttcaccatg
acctcgaatgatggaatggatctgaaaccgatttttggaccgggactcacaggcttgcgc
aatctcggcaacagttgctacctggctagtgcccttcaatgcttgttttcccttcctgaa
tttggatgtcgatattttaagccaacagaacaaccgcctgccgtacctctaccagccgaa
gatcttgaaacacaattaagaaaacttgcagatgggctgatgtcaggacgttattccgtc
ccagactcggatgcggtagcacacacgagttctaaggatctaccgtatcaaacgggatta
tctccagggatgctaaaacatttaattggtcgcggccatgatgaattctcgacaatgcgg
cagcaagatgcctttgaactcctcttgcatcttttcaaacttattaacctcagtaaacac
tctgatcttctaaatccagtgacctcgttccgttttgcattggagcagcggttgcagtgt
ttatcatgtgggaaggtgcggtataaagttgatgaacaagataatatttcaatttcagtt
ccagtccgtcgtttaagcgaaaaagataacgttggctcccaaacaagcgaaacaaaacca
acccagtcgaactttcagcgtgttaccatcagggagtgccttgatatttttacggctgaa
gaagtcgttgagttgacatgctctgggtgcggaagcaaggacggctttcgaaagcgatca
ctctttaaaaccgtcccccagaatttgttagtcaacgcgagacgatttgaactggttaat
tgggtgcctaccaaacttgatatccccgttgaagtgagtgacgagcctttagatttcggc
cagtatctatcgtcgggccctcaggaaggcgagattcttttagaggatgctccttctccc
aagaagattgactttcaaccgaacgcggaagcagttaacatgttacatagcatgggattc
cctgaagttcgtattaagaaggcgctctacgccacagggaatgtagacgtggacgctgca
ttgaattggctattcgcacatatggatgacccggatatcgatgcaccgggcatctttgca
gaaccagaaaatgaagacaaacaagactcaaaagcggacgaagcaaaggttgatcagttg
tttgacatgggcatcgatcgttcaaaagcacgaaaggcacttttagaaacgtcgggagat
attaacagggccttagattgggctttaaaccatcaagatgaccctgagcttgaggaaatt
gagctagatggtaaacccaccccggagcttcctgggtccactgatacacctgctctttat
cggctacattccttaatttgccacaaaggggcctcggttcacactgggcattatgttgca
tttgtgcacaaacagcttccgaatcaaacacatcatagctgggttcttttcaatgatgaa
aaggtcgttcagggtggtgacattgaagagatgaaacaatttgcatacatctattttcta
agaaaattatag

DBGET integrated database retrieval system