KEGG   Uncinocarpus reesii: UREG_05709Help
Entry
UREG_05709        CDS       T01132                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ure  Uncinocarpus reesii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ure00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 229 aa AA seqDB search
MATAVRKFRPVVIFGPSGTGKSTILKRLFAEYPDKFSFSVSHTTRAPRLGEKDGREYYFT
TKDGFLQLVAEGGFIEYAQFGGNYYGTSTRAVREIMNQGKVCVLDIEMEVWTPLVPARLI
LCLSRALANEPGKTLQQGVKQLKKTDLNARFLFLAPPSMEELERRLRGRGTETEDSLHKR
LTQAKNEVEFAKQPGSHDKTVVNDDLETAYQTVKDWVVDNGDFGEMRAS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgcagtgcgcaagttccgtcccgtggtaatcttcggcccatcaggaaccggc
aagtccacgatcctcaaacggctctttgccgaatatcctgataaattcagcttctccgtc
tcccataccacccgtgctcctcgtctcggcgagaaagacggtcgcgaatactacttcacg
accaaagatgggtttttacagttggttgctgaaggtggctttattgaatacgcccagttt
ggcggcaactattatggaacgagcaccagggcagtaagagaaatcatgaaccagggaaaa
gtgtgcgttttggatattgaaatggaggtatggactcctctggtgccagctcggctcatt
ctttgtctttcgagagcgttggctaacgagccggggaaaaccctacaacagggtgtcaag
cagcttaaaaagacagacctcaatgcgagattcttattcctcgctcctccatcgatggag
gaacttgagcgcagattgcgtggccgtggcacggagacggaggatagcctacataaacga
ttaacacaggcgaagaacgaggtggaattcgccaaacagccaggttctcacgataagact
gtcgtcaatgacgatctcgagacggcatatcaaacagtgaaagattgggtcgtggataat
ggggattttggcgagatgcgtgcatcttga

DBGET integrated database retrieval system