KEGG   Uncinocarpus reesii: UREG_05729Help
Entry
UREG_05729        CDS       T01132                                 

Definition
Poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
ure  Uncinocarpus reesii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UREG_05729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MSGLFGSASPAGSSGDISKDVALSSPPDDSISDLAFSSASDHLAVASWDKKVRIYEINEQ
GQSEGKALFEHQAPVLSCCWSPDGTKVVGAGVDKAARMLDLAGNLSNPIQVAAHEAPIRC
CRMISNPGNSSQPLLITGSWDKTVKYWDLRQQTPIGSLDCQERIYTIDVNNKLLVIGTAD
RYINIVNLDQPTKFYKTMQSPLKWQTRVVSCFADATGFAVGSIEGRCAIQYVEEKDSGKN
FSFKCHRESPPNNVNLSNVYSVNAISFHPTHGTFSTAGSDGTFHYWDKDAKHRLKGFPNV
GGTISSTAFNRNGNIFAYAVSYDWSKGYTANTQQTPNKVMMHPVGPEELRPRAAANRRTR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcctcttcggctcagccagccctgctggttcttcgggcgacatttcaaaggat
gtcgccctgtcttcgccgccggatgatagtatctctgatctcgctttttcgagtgccagc
gatcaccttgcagtggcatcttgggacaagaaagtccgcatttatgaaatcaatgaacaa
ggacaaagtgaagggaaggcgttattcgagcatcaagcacctgtgttgagttgttgttgg
tcacccgatggaactaaagttgttggtgccggtgttgataaagccgctcgtatgctcgat
ctcgcgggcaaccttagcaaccctattcaagtcgctgcgcatgaagcgcccattcgatgt
tgccgcatgatttcgaacccgggaaactctagccagccactgctcatcaccgggtcgtgg
gataaaacagtcaagtactgggatctgcggcagcaaacgcccatcggatctctcgattgt
caagaacggatatacacaatcgacgttaacaataaacttctggttattggaaccgcagat
cgatatatcaatattgtgaatctggaccagcccacgaaattctataaaacaatgcagtct
cccctaaaatggcagaccagagttgtcagctgcttcgcagatgccaccggatttgctgtt
ggaagtatcgaaggccgatgtgcgattcagtacgttgaagagaaggactctggcaagaat
ttcagcttcaaatgccaccgcgaaagccccccgaacaacgtgaacctcagcaatgtttat
tcagtgaatgccatttctttccacccaacacacggcacttttagtacggcaggcagtgat
ggtacattccactactgggacaaggatgccaagcacaggctcaaggggttccccaacgtt
ggaggaaccatttccagtactgctttcaaccgtaatggaaatatctttgcctatgctgtg
agctatgactggagcaagggatataccgccaatacgcaacaaacaccgaacaaggtcatg
atgcaccccgttggccctgaagaactacgaccccgtgccgccgccaaccgtaggaccaga
tga

DBGET integrated database retrieval system