KEGG   Uncinocarpus reesii: UREG_05841Help
Entry
UREG_05841        CDS       T01132                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ure  Uncinocarpus reesii
Pathway
ure00260  Glycine, serine and threonine metabolism
ure00750  Vitamin B6 metabolism
ure01100  Metabolic pathways
ure01110  Biosynthesis of secondary metabolites
ure01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UREG_05841
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    UREG_05841
Enzymes [BR:ure01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     UREG_05841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 8443586
NCBI-ProteinID: XP_002585152
UniProt: C4JTQ2
AA seq 768 aa AA seqDB search
MSHTDSQRYLSTRGGSYDLSFEEVVLKGLASDGGLFIPEAIPSLPSDWQSKWRSYSFQEL
AFEIFSLYISPSEIPPNDLKDIIARSYGTFRAPDITPLVTLEEKKKLYLLELFCGPTFAF
KDVALQFLGNLFEYFLVRRNQGKTGKDRHHLVVVSPIQEAQMTTVLDSNVHNLSVEGSFD
DCQDIVKALFADPEINRAHKLAAVNSINFARILAQMTYYFHSYFQLIRSPSYIEGKPVRF
VVPSGNFGDILAGWFAKEMGLPAEKLVIATNENDILDRFWKTGAYTKQAQARDASAGSGD
EIANAQGSVKETLSPAMDILVSSNFERLLWYLAFEVKCEGDITKRRASAGETVRTWLNEL
KTKGGFSVDSKVLSLAQKDLESERVSDDETIETIRYTYSTCFPGGPASHGTRGQTGGYIL
DPHSAVGVAASLRSISRFPESFHISLSTAHPAKFAQAVDLALRGQHGYSFDEVLPPEFVG
LEHKERRIIVVPAGEGWQTPKRDPISKAERPRVRSGAPYGMMKQAGAFPLYYIKHRLKSD
LHALNGAFANHERAIQTEQPQLPYNQVLKTAYERLAIETHTQPQACNDRTATQLLDEESS
IFAASISTWPAFHDTVDAMRRLKTRFKLVPISNVDRASFDKTLRGPLAGVHRDLAGSHEP
FFDAVYTAQDIGSYKPDLRNFEYLISRAKRDLGVEKDDILHVAQSLYHDHEPAKKVGLNS
VWIARGEGGASAMGGEVAEYVATGKVAFGWKFASLGELADAIDKEAAE
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcataccgattcccaaagatatcttagtacgcgaggaggttcttacgatctctcc
ttcgaggaggtcgtacttaaaggccttgcatcagacggcgggcttttcattcccgaagcg
ataccttctttaccttcggattggcaatctaaatggcgcagctacagttttcaggagctt
gcgtttgaaatcttctcgctgtatatctcgccgtcggaaattccgccgaatgacttgaaa
gatatcattgcgcggagctacgggacgtttagggcgccagatatcaccccgctagtaacc
ttggaagagaagaagaagctatatctgttggagctgttttgcgggccgacctttgcgttc
aaagatgtcgcattgcagttccttggtaatctgtttgaatacttccttgtccgacggaat
cagggcaaaaccgggaaggataggcatcaccttgttgtcgtctctcccatccaagaagca
caaatgacgacagtgctagattcgaatgttcataatctcagtgtggaagggtcctttgat
gattgtcaggatatcgtgaaggccctattcgccgatcctgaaatcaatagagctcataag
ctagcggccgtgaactccataaatttcgctcgtatcttggcgcaaatgacatattatttc
cattcctacttccagcttatccgttcgccaagttacatcgaaggcaagccagtgaggttc
gtggtgccatcagggaattttggcgatatcctcgcaggctggttcgccaaggaaatgggt
cttcccgcagagaaactggttattgcaacgaatgaaaacgatattcttgaccgtttctgg
aagacgggggcatatacgaaacaagctcaagcccgcgatgccagcgccgggtcaggagat
gaaatcgccaacgcacaagggagcgtgaaagaaactctgagcccagccatggacatcctt
gtctccagcaacttcgaacggctactctggtaccttgcattcgaagtaaaatgcgaaggg
gacattaccaaacgacgcgcgtccgctggcgaaaccgtccgcacatggctcaacgaacta
aagaccaagggaggtttcagcgtagactccaaggtcctatcgctggcacaaaaagattta
gaaagtgagcgcgtgtcggacgacgagaccatcgaaacgatccgctatacctattcgacg
tgctttcccggcgggccagctagccatggaaccagaggtcaaacaggcggctatattctc
gaccctcactccgcagtcggtgtcgcggcatcgctgcgatctatctcccgtttccccgaa
tcattccacatttcactgtccacggcgcatccggcgaaatttgcgcaagctgtcgacctt
gcgttgcggggccaacacggctactcctttgatgaagtcttaccgccggagtttgttggg
ctggaacataaggagcgccggatcattgtggtgcctgcaggcgagggatggcagactccc
aaaagagacccgatcagcaaagctgagcgaccccgcgtgcgtagcggggcgccttatggc
atgatgaagcaggctggagctttcccactctactatataaaacaccgattgaaatccgac
ctccatgctctcaacggcgcctttgctaaccacgagcgcgccatccaaaccgagcaaccg
cagctgccatacaaccaggtcctcaaaaccgcctatgaacgcctggcaatcgagacacac
acccaaccccaggcatgtaacgatcgaacagcaacccaactcctggatgaagaatcatcc
atcttcgccgcctccatctccacctggcctgctttccacgacaccgtcgacgcaatgcgc
cggctgaaaacccgctttaagctagtcccaatctcgaacgtcgaccgtgcctcgtttgac
aaaaccctccgcggccccttagccggagtccatcgtgacctcgcgggctcacatgaacct
ttcttcgacgcggtctacacggcgcaggatatcgggtcgtataaacccgatctgcgcaat
tttgagtatttgatatctcgtgccaagcgggatctaggggtggagaaggatgatattttg
catgtcgcgcagagcttgtatcacgatcatgagccggcgaagaaagtcgggttgaatagt
gtttggattgctaggggtgagggtggtgccagcgcgatgggtggggaggttgcagagtat
gttgcgacgggaaaggtggcttttggatggaagtttgctagtttgggggagctggcggac
gcaattgacaaggaagcggctgagtag

DBGET integrated database retrieval system