KEGG   Uncinocarpus reesii: UREG_05841Help
Entry
UREG_05841        CDS       T01132                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ure  Uncinocarpus reesii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UREG_05841
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UREG_05841
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    UREG_05841
Enzymes [BR:ure01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     UREG_05841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 768 aa AA seqDB search
MSHTDSQRYLSTRGGSYDLSFEEVVLKGLASDGGLFIPEAIPSLPSDWQSKWRSYSFQEL
AFEIFSLYISPSEIPPNDLKDIIARSYGTFRAPDITPLVTLEEKKKLYLLELFCGPTFAF
KDVALQFLGNLFEYFLVRRNQGKTGKDRHHLVVVSPIQEAQMTTVLDSNVHNLSVEGSFD
DCQDIVKALFADPEINRAHKLAAVNSINFARILAQMTYYFHSYFQLIRSPSYIEGKPVRF
VVPSGNFGDILAGWFAKEMGLPAEKLVIATNENDILDRFWKTGAYTKQAQARDASAGSGD
EIANAQGSVKETLSPAMDILVSSNFERLLWYLAFEVKCEGDITKRRASAGETVRTWLNEL
KTKGGFSVDSKVLSLAQKDLESERVSDDETIETIRYTYSTCFPGGPASHGTRGQTGGYIL
DPHSAVGVAASLRSISRFPESFHISLSTAHPAKFAQAVDLALRGQHGYSFDEVLPPEFVG
LEHKERRIIVVPAGEGWQTPKRDPISKAERPRVRSGAPYGMMKQAGAFPLYYIKHRLKSD
LHALNGAFANHERAIQTEQPQLPYNQVLKTAYERLAIETHTQPQACNDRTATQLLDEESS
IFAASISTWPAFHDTVDAMRRLKTRFKLVPISNVDRASFDKTLRGPLAGVHRDLAGSHEP
FFDAVYTAQDIGSYKPDLRNFEYLISRAKRDLGVEKDDILHVAQSLYHDHEPAKKVGLNS
VWIARGEGGASAMGGEVAEYVATGKVAFGWKFASLGELADAIDKEAAE
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcataccgattcccaaagatatcttagtacgcgaggaggttcttacgatctctcc
ttcgaggaggtcgtacttaaaggccttgcatcagacggcgggcttttcattcccgaagcg
ataccttctttaccttcggattggcaatctaaatggcgcagctacagttttcaggagctt
gcgtttgaaatcttctcgctgtatatctcgccgtcggaaattccgccgaatgacttgaaa
gatatcattgcgcggagctacgggacgtttagggcgccagatatcaccccgctagtaacc
ttggaagagaagaagaagctatatctgttggagctgttttgcgggccgacctttgcgttc
aaagatgtcgcattgcagttccttggtaatctgtttgaatacttccttgtccgacggaat
cagggcaaaaccgggaaggataggcatcaccttgttgtcgtctctcccatccaagaagca
caaatgacgacagtgctagattcgaatgttcataatctcagtgtggaagggtcctttgat
gattgtcaggatatcgtgaaggccctattcgccgatcctgaaatcaatagagctcataag
ctagcggccgtgaactccataaatttcgctcgtatcttggcgcaaatgacatattatttc
cattcctacttccagcttatccgttcgccaagttacatcgaaggcaagccagtgaggttc
gtggtgccatcagggaattttggcgatatcctcgcaggctggttcgccaaggaaatgggt
cttcccgcagagaaactggttattgcaacgaatgaaaacgatattcttgaccgtttctgg
aagacgggggcatatacgaaacaagctcaagcccgcgatgccagcgccgggtcaggagat
gaaatcgccaacgcacaagggagcgtgaaagaaactctgagcccagccatggacatcctt
gtctccagcaacttcgaacggctactctggtaccttgcattcgaagtaaaatgcgaaggg
gacattaccaaacgacgcgcgtccgctggcgaaaccgtccgcacatggctcaacgaacta
aagaccaagggaggtttcagcgtagactccaaggtcctatcgctggcacaaaaagattta
gaaagtgagcgcgtgtcggacgacgagaccatcgaaacgatccgctatacctattcgacg
tgctttcccggcgggccagctagccatggaaccagaggtcaaacaggcggctatattctc
gaccctcactccgcagtcggtgtcgcggcatcgctgcgatctatctcccgtttccccgaa
tcattccacatttcactgtccacggcgcatccggcgaaatttgcgcaagctgtcgacctt
gcgttgcggggccaacacggctactcctttgatgaagtcttaccgccggagtttgttggg
ctggaacataaggagcgccggatcattgtggtgcctgcaggcgagggatggcagactccc
aaaagagacccgatcagcaaagctgagcgaccccgcgtgcgtagcggggcgccttatggc
atgatgaagcaggctggagctttcccactctactatataaaacaccgattgaaatccgac
ctccatgctctcaacggcgcctttgctaaccacgagcgcgccatccaaaccgagcaaccg
cagctgccatacaaccaggtcctcaaaaccgcctatgaacgcctggcaatcgagacacac
acccaaccccaggcatgtaacgatcgaacagcaacccaactcctggatgaagaatcatcc
atcttcgccgcctccatctccacctggcctgctttccacgacaccgtcgacgcaatgcgc
cggctgaaaacccgctttaagctagtcccaatctcgaacgtcgaccgtgcctcgtttgac
aaaaccctccgcggccccttagccggagtccatcgtgacctcgcgggctcacatgaacct
ttcttcgacgcggtctacacggcgcaggatatcgggtcgtataaacccgatctgcgcaat
tttgagtatttgatatctcgtgccaagcgggatctaggggtggagaaggatgatattttg
catgtcgcgcagagcttgtatcacgatcatgagccggcgaagaaagtcgggttgaatagt
gtttggattgctaggggtgagggtggtgccagcgcgatgggtggggaggttgcagagtat
gttgcgacgggaaaggtggcttttggatggaagtttgctagtttgggggagctggcggac
gcaattgacaaggaagcggctgagtag

DBGET integrated database retrieval system