KEGG   Uncinocarpus reesii: UREG_05912Help
Entry
UREG_05912        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ure  Uncinocarpus reesii
Pathway
ure00600  Sphingolipid metabolism
ure01100  Metabolic pathways
Module
ure_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    UREG_05912
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     UREG_05912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 8444305
NCBI-ProteinID: XP_002585223
UniProt: C4JTX3
AA seq 399 aa AA seqDB search
MTIGSLLDCDRCPDGYSSSEEEQLHRSALGKGSILTVGKQVSLILTAKSLAVIAQTPRNR
TIPYFNVFTLLLNGLCNNHAVEIAQKIDIQAYDVIVPASGDGVVYEVFNGLGQRADACEA
LSKLAVAHIPCGSGNAMSYNLYGSGTPSMAALCIVKGLRTPLDLVSITQGDRRILSFLSQ
SFGIIAESDLGTDNIRWMGSARFTYGFLVRLLGKTVYPCDLAVKVEVDGKERIKDHYRSE
SQQKSAHSTAGDEPRSPGLPPLRYGTVTDPLPDDWELITHDKMGNFYAGNMAYMAPDANF
FPTALPNDGLLDLITIRGDIPRLTALQMLMAVENGTLFDMPEVNIRKVSGYRIIPRDRED
GYISIDGEKVPFEPFQAEVHPGLGTVISKSGYKYETPGI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgactattggcagcttgctcgattgcgaccggtgcccggacgggtactcatcgtctgaa
gaagaacaactgcaccgttcggcattggggaagggctcgattcttacagttgggaagcag
gtctcgttgattttgactgcaaagtctcttgccgttatcgcgcagactcctcggaaccgg
acaatcccgtatttcaatgttttcacccttctcttgaatggcctatgcaacaaccatgct
gtggagattgcgcagaaaatcgatattcaagcgtacgacgtgattgttcctgcatccggg
gatggtgtggtatacgaggttttcaacggcctaggccagagagctgatgcatgtgaagca
ctttccaaacttgcggtagctcatatcccatgtggctcggggaatgcgatgagttataac
ctttatggttcaggcactccgagcatggctgcactttgcattgtcaaaggcttgagaacg
ccgttggaccttgtctccatcacacaaggagaccgaagaatactatcctttttgtcccaa
tctttcggtattattgccgaaagcgatcttggtacagacaatatccggtggatgggaagc
gcgcgttttacgtacgggtttttggttcgattgcttggaaaaacagtatatccatgtgat
cttgctgtcaaagtcgaagttgatgggaaggaacgtatcaaggaccattatcgatcggaa
tcgcagcaaaagtcagctcattcgaccgcaggagacgagcctagaagcccgggtctccca
cccctcagatatggcactgtcacagatcctcttcccgacgactgggagctcataacccac
gacaaaatgggcaatttttacgctggaaacatggcgtacatggcgcccgatgccaatttt
ttcccaactgcactaccaaatgacgggctactggacctgataacaatccgtggggacatt
cctcgcctaaccgcgcttcagatgctcatggctgttgaaaacggtactctattcgacatg
ccagaggtgaatattcgaaaagtttcaggttacagaatcatcccccgagacagagaggat
ggttatataagtatcgatggagagaaggtgccgtttgaacccttccaggcagaggtccac
ccaggacttgggaccgtgatctcgaaatctgggtacaagtacgaaacccccgggatttag

DBGET integrated database retrieval system