KEGG   Uncinocarpus reesii: UREG_06239Help
Entry
UREG_06239        CDS       T01132                                 

Definition
similar to ubiquitin specific protease 11
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     UREG_06239
Peptidases [BR:ure01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UREG_06239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1102 aa AA seqDB search
MSSPNGGNGTPAIQDQQMQDVQNDHTIHRSSSPALKRPAAEMGGDEHRENRDHMDTDSPG
GNNSTESSLDTSKLKKKDDRPELHTRAASVDMIGRGDEATSQPDGGQTSSEDPTGSGSDS
VYPTPSSMSAYTSSTYEDRSQAISSQSSHSSHDIPSFEQQVAIVMRMNMAPPKDKQRGYV
VSGTFLKKVLARKEGTDKNALEGEIGPVDNSDLVLVTDPSMLFKDEVGEPFIPLRPGLQI
GNDFEIFPQEAWDLIMKWYGLAKNSPVIVRYAHNTSTAEYVEHVQYELNPPIFTVLKLQS
STTPSNRNSPSIKEPPVKFLASSHTPFQQWLKNAKKLAAIEPTTKVRVWRILEGLGSSGN
VTPATSRNPSPAPGAFLIGNAGNSLVLDVTKFVALNEGSQRELLELKDQTGNEKYNGNIT
LHIAGLAMDSVIVLEEQIGGPGGGEWVSDTAKYGSSRLAALTTTAKGGPQNKIKTAAATA
SGRASPVSTVASRGRKRKDGKTRGVTGLSNLGNTCYMNSALQCVRSVEELTQYFLSNEYK
KDLNPSNPLAHNGEVAKAYANLLHQMFDENAAASIAPRNFKHTVSKYGPSFSGYGQHDSQ
EFVLFLLDGLQEDLNRIHKKPYIEKPDSTDDMVSDKAALERFADRNWEIYKARNDSVITD
LFAGMYKSTLVCPVCDKVSIIFDPFSNLTLQLPIENIWSRKIQYHPARGESIELEVDIDK
NASVMALKEYVAKRVNTDPRRLVMAEVFSRKIYKLFTNTPAISECNIGTSDVIAMYELET
VPTSYDPDKAKKQNHSMLYTAFRDDDADVASFDSERADRILVPIFHREVKAFSTKSHRQR
PLFGIPRFAVITREEAMDYDAILRKILAQVDNMTTQDILHESENDVTMRHQSAEDSDAVV
TNDDDANSNDSKIKMGSVEGEDGLVDVSMRDATDTSSQADSTKSSKTCMPGVLQPGSFIP
PSLRNMFEVKFVKTHDPAGIIYSTIDDSKEFTPMLGRVRSKKVAKRGASRTKNIPPLRSN
NSPMSSEDELAGPAISVQVPGSKVHDVGYSSSEETKGNSGSGSDSDRFPTVRPIRRKEKG
RKQKNRCSKPNPPANLPLYSPR
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccccgaatggtggaaacggcacgcccgccatccaagatcagcaaatgcaggat
gtccagaatgatcatactatccaccgatcctcctctcctgcattgaagcgccctgcagcg
gaaatgggtggcgatgaacacagagaaaaccgagaccacatggatacagattctcccggc
ggcaataacagtaccgaatcttcgctagacacctcaaagctgaaaaagaaggacgatcgg
ccagaactacatacccgggccgcttctgtcgacatgatcggccggggtgacgaggccaca
agccagcctgatggcggtcaaacctcgtcggaagaccctactgggtccggatccgatagc
gtctacccaacaccgtccagtatgtcggcctacacgtcgtcgacatacgaggatcgatcc
caggcgatttccagtcaatcgagccattcttcccacgatatccctagctttgaacaacag
gttgcaatcgtcatgcgaatgaacatggcacccccaaaagataaacagcgaggatatgtc
gtgtccggaacctttctaaagaaagtccttgcacggaaagaaggaactgacaaaaatgca
ctagagggtgaaattggcccagtcgacaattctgacctcgttctggtcaccgatcccagc
atgctgtttaaggatgaagtcggagaaccattcattccgctccgtccagggctacaaatc
ggaaacgatttcgaaattttccctcaggaagcgtgggatttgatcatgaaatggtatggc
ctggcgaagaattctcctgtcatcgttcgatacgcccataatacaagcactgccgaatat
gtcgaacatgttcaatatgagctgaatccgccaatattcaccgtattaaaactacaaagt
tcgactactccctctaatcggaattcaccgtcgatcaaggagccccccgtcaaattcctg
gccagcagccatactccctttcagcaatggctaaagaacgctaagaagctagcggccatc
gaaccgaccacaaaggtccgtgtctggagaatccttgaaggcctagggtcatctggcaat
gtgacacccgccacctcccgcaatccttccccagctcccggtgcttttctgattggaaat
gctggaaatagtttggttctcgatgttaccaagttcgttgcgttgaatgaaggctctcaa
cgggagctcctcgaactgaaagaccagaccggaaacgaaaagtacaacggcaacatcacg
ctgcacattgctggcctcgccatggatagtgtaattgtgcttgaagagcaaatcggtggt
cctggcggtggtgagtgggtttcagataccgcaaaatatgggtcaagccgacttgctgcc
ttgaccacaactgcaaagggtgggcctcaaaacaaaatcaagaccgctgctgctacagct
agtgggcgtgcatctcccgtttccactgttgctagccggggacggaaacgtaaagatggc
aaaactcgtggtgtgaccggcctcagcaacctcgggaatacctgctacatgaattcggct
ctgcaatgcgtgcgaagtgtcgaagagctcacgcaatatttcctgtcaaatgagtataaa
aaggatctcaacccgagtaacccactagctcacaacggtgaagtggccaaagcatatgcc
aacctcctccaccagatgtttgacgaaaacgcagcagcttccattgcgccccggaatttc
aaacatacggtctcgaaatacggcccgtcgttttctggttatggtcaacatgattcccaa
gaatttgtcctttttctccttgatggtttgcaggaggacctaaataggatccataagaaa
ccgtatatcgagaagcctgattccacggatgacatggtcagcgacaaagccgctttggaa
aggttcgctgaccggaactgggaaatttacaaggcacgcaacgactcagtgattactgat
ttattcgccgggatgtacaagtccacacttgtctgtccagtttgcgataaagtaagcatc
atattcgatccgttcagtaacttgaccctccaattaccgatcgaaaatatatggagccga
aagattcaatatcaccctgctcgtggcgagtccattgagttggaggtggacattgacaag
aatgctagtgtcatggccctgaaggaatatgtcgcgaaaagggtgaacactgatccacga
cgccttgtcatggctgaggttttctctagaaagatctacaagttgtttaccaatactccg
gccataagtgaatgtaatattgggacatcggacgttattgccatgtatgaactggaaacg
gttccaaccagttacgaccccgataaggcgaaaaaacaaaaccacagcatgctttatacg
gctttccgtgatgatgacgcagatgtcgcctcttttgactcggaaagggccgatcgcata
ctagtccctattttccaccgtgaggtcaaggctttctcgacaaaatcgcaccgccagcgg
ccgctatttggtattcccagatttgcggttatcacccgcgaagaagcgatggattatgat
gcaatcttgcgaaagatcttagcccaagtggacaatatgacaacgcaagatatccttcac
gaaagcgaaaatgatgtgaccatgcgacaccagtctgctgaagactctgatgcggttgtt
accaatgacgacgatgccaattctaatgattccaaaatcaaaatgggttccgtggaggga
gaggacggtttagttgacgtgtctatgcgcgatgccactgatacctcgtcacaagcagac
agcacgaaatcatccaagacgtgcatgccaggtgtccttcaacctgggagctttatcccc
ccttctcttcgaaatatgtttgaagtcaaattcgtgaagacccatgatcctgcaggcata
atctattctaccattgatgattccaaggaatttactcctatgttaggtagggtacggtca
aagaaagtagctaaacgcggcgcctcgcggacgaaaaatatcccgcctcttcgctcaaac
aatagcccgatgagcagtgaagatgaactcgctgggccggccatctccgtgcaggtccct
gggagtaaggttcatgacgtcggttattcgagttctgaagagacaaaaggcaacagtggt
tcagggagcgactcggatcggttccctaccgtccgcccgatccgaaggaaagaaaagggc
cgaaagcaaaagaatcgctgctccaagcccaatcctccggccaatcttcccttatattcg
ccccggtga

DBGET integrated database retrieval system