KEGG   Uncinocarpus reesii: UREG_06303Help
Entry
UREG_06303        CDS       T01132                                 

Definition
similar to kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     UREG_06303
Protein kinases [BR:ure01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   UREG_06303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 464 aa AA seqDB search
MWKASERLMDTIGHYASFPATGVSLRQMVQFGHRPSTGMLDTGVYYCFCQPTGAQAVLNL
VLWKITGTLFRASQFLSEELPIRLAHRVQELGDLPDGLNDVPSIKKVQDWYAQSFEEIIS
LPRPTLSQEVRSRLLRPSRQPGREPKVLEEATQNPSIKDGRYRSSTTSILPQTKDYCING
NGNGSGNGNGHSKHRVSGNRRYFVAADDGGEWPPELRDYNNRFASTLHHIKRRHDSVVTT
VAQGILEWKRKRQRMQIDSDIQSFLDRFYMSRIGIRMLIGQHIALTQQTHEYHPNYVGII
CTKTNVRELAQEAIENARFVCEDHYGLFDAPKVRLVCKDDLNFMYVPGHLSHMLFETLKN
SLRAVVETHGPESDVFPEIKVIVAEGREDITIKISDEGGGIPRSSIPLVWTYMYTTVDQT
PNLDPDFNKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggcgtcagaacgactgatggacaccatcggtcactatgcttcgtttccagcg
acaggagtctctctgcggcagatggttcagttcgggcacagaccatcaacaggtatgtta
gatacaggtgtgtactattgcttctgtcaacctaccggagcccaggcagtgcttaacctt
gtcctatggaaaatcacaggcacgctcttccgcgcatcccagtttctgtccgaagaactt
cccattcggttagcacacagggtacaggagctgggtgatctgccagatggactgaacgac
gtgccttcaatcaaaaaggtgcaagactggtatgcgcagtcttttgaggaaatcataagc
ctcccccggccaacactctcgcaagaagtcagatcccgtctcctgcggcccagtcgccag
cctggccgtgagccgaaggtgctggaggaggcgacacaaaaccctagtataaaagacggc
cggtatcgctcctccacaacgtccatccttccacagacaaaagactattgcattaacggc
aatggcaatggaagcgggaatgggaacgggcattcaaaacatagagtcagcgggaaccga
agatattttgttgctgcagacgacgggggcgagtggccacccgaactccgggattacaac
aatcgcttcgcgtcgaccttgcatcacatcaagagaaggcacgatagtgtggtcacaact
gtggcgcagggcatcctagaatggaaacgaaaaaggcagcgaatgcagattgattcggat
atacaatcattccttgatcgattctacatgtctcgcatcggtattcgaatgcttatcggc
caacacattgccctcacacaacagacgcacgaataccacccaaactacgttggaatcatc
tgcaccaagactaacgttagggaactcgcccaagaagctattgagaatgcacggtttgtt
tgtgaggatcattacgggttattcgatgcccccaaagttcgtcttgtttgcaaagatgat
ctgaatttcatgtatgtcccaggccatttgtcgcatatgctcttcgaaacgttgaaaaac
tcgttacgtgccgttgtggaaacccatggcccggagagtgatgtattcccagagatcaaa
gttatcgttgcggaaggtcgcgaggacataacgatcaaaatatcggatgaaggaggcggg
attccaaggtcatccattccgcttgtttggacgtacatgtataccactgtggatcagact
cctaatctggacccggatttcaacaaaagcgatttcaaggctccaatggctgggtttggt
tatggacttccaatcagtcggctttacgcacggtatttcggcggtgacttgaagctgata
agcatggaggggtaa

DBGET integrated database retrieval system