KEGG   Uncinocarpus reesii: UREG_06312Help
Entry
UREG_06312        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     UREG_06312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 290 aa AA seqDB search
MAELPSRLRISQFLILKPHQLSGHGTQLYQTIHRAAREDPTVYELTVEDPNEAFDALRDT
NDYHLLEPIFGQHNITINPDPIPAKQGRPRHPRSVPTSLLIPTDTLRKLRIEYKIAPTQF
AHLVEMYLLSLIPMSHRGSHNVNLARLRIQKSRASNEHDRRYYWWRMLVKQRLYKRHRDM
LIQVEPAERVEKLEETLHNVEEGYENLLKAFEMKVPRDDTEGATPIVDQQQIQVEDRETR
VGDSLVKERTKRKLVVMEDEDGDDDPSAAANSAEGGGEGDANAPFKKTKV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactaccgtcacggcttcgcatttcccaatttctcatcctcaaaccccaccaa
ttatcgggccatggcacgcaactttatcaaacgatccatcgcgcagctcgtgaagaccct
acagtctatgaacttacagtcgaagacccgaatgaggcctttgatgccctccgtgacacc
aatgactaccatctgctcgaacccattttcggacaacacaatatcacaatcaacccagat
ccaatacctgcaaaacaaggccgtcctcgtcacccccgctccgtcccaacgtccctgctt
atcccaacggatacattgcgcaagttgcgcatcgagtacaagattgcgcccacccagttc
gcccacttagtagaaatgtacctcctcagccttatccccatgtctcaccgtggctctcac
aacgtgaacttggcacgactccgtatccaaaagtctcgtgcttcgaacgagcacgaccga
cgatactactggtggcgcatgcttgttaagcagcggctgtacaagcgtcatcgcgacatg
ctgattcaagttgagccggccgaacgtgtggaaaaactggaagagacactgcataacgtg
gaagagggatatgaaaatttactcaaagctttcgagatgaaagtgccccgggatgacacg
gaaggcgcgacgcctattgtggatcagcaacagattcaagttgaagaccgagagacacgt
gtaggggattccctcgtcaaagagagaacaaagagaaagttggtggtcatggaggatgag
gatggggacgacgacccttcagccgctgctaatagtgcagaaggcgggggtgaaggggat
gccaatgcccccttcaaaaagaccaaggtgtaa

DBGET integrated database retrieval system