KEGG   Uncinocarpus reesii: UREG_06457Help
Entry
UREG_06457        CDS       T01132                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ure  Uncinocarpus reesii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    UREG_06457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 140 aa AA seqDB search
MSIAELPLVVTAIELEERWKKEMAQEQEQLANKSVQPGDAAKGANLFKTRCASCHTLEQG
GANKVGPNLHGLFGRKTGQVEGFSYTDANKQKGITWDHNTLFTYLENPKKYIPGTKMAFG
GLKKAKDRNDLITYMEQETK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgccgagctgccccttgttgttacagccattgagctggaggagcgatggaag
aaggaaatggcacaggaacaggaacagctggctaacaagtctgtccaaccaggcgatgcg
gccaagggcgccaacctcttcaagacccgctgcgcttcatgccacaccctcgagcagggc
ggtgccaacaaggtcggccccaacttgcacggtctcttcggccgcaagaccggtcaggtt
gagggtttctcctacaccgatgccaacaagcaaaagggcatcacctgggatcacaacaca
ctcttcacctacctcgagaaccctaagaagtacattcccggcaccaagatggcctttggc
ggtcttaagaaggccaaggatcgcaacgacttgatcacctacatggagcaggagaccaaa
taa

DBGET integrated database retrieval system