KEGG   Uncinocarpus reesii: UREG_06483Help
Entry
UREG_06483        CDS       T01132                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ure  Uncinocarpus reesii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UREG_06483
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UREG_06483
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    UREG_06483
Enzymes [BR:ure01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     UREG_06483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 723 aa AA seqDB search
MDGIKQTFAKCKQEGRSALVAYVTAGYPHPDETVDIVLGMEEGGADVIELGVPFTDPIAD
GPTIQRANTRALEHGVTMTSVLKMVRTARDRGLRAPVLLMGYYNPLLRYGEERLLKDAKA
AGVNGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSDSRMKLLCKIADSFIYVVSRM
GVTGATGRLSSGLPELLSRVHSYSGNIPAAVGFGVSTREHFLSVQEIAEGVVIGSQMITV
LGNAPAGQGAQKVKEYCTSITGRTVDRSKLSEPLTREVGLTEAITEAEKPTGVHVDRVIK
EASTSGPGLADQLEALNVTGDPAAIPARFGEFGGQYVPESLMDCLAELEAGFNEANNDPK
FWEEYRSYYPYMGRPSNLHFAQRLTEHAGGANIYIKREDLNHTGSHKINNALGQVLLARR
IGKTRIIAETGAGQHGVATATVCAKFGMECVVYMGAEDVRRQALNVFRMKLLGASVVAVE
AGSRTLRDAVNEALRAWVVDLPTTHYVIGSAIGPHPFPTIVRTFQSVIGEETKKQMKELT
GRLPDAVVACVGGGSNAVGMFYPFANDPSVKLLGVEAGGDGVESGKHSATLSGGTKGVLH
GVRTYVLQDEHGQISETHSISAGLDYPGVGPELSSWKDSSRAEFIAATDAQALIGFRTIA
QLEGIIPALESSHAVYGVIELAKKMEKGKNIVLNLSGRGDKDVQSVADALPAIGPKIGWD
LRF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggacggtatcaagcagacctttgcgaaatgcaagcaagaagggcgctctgccttggtg
gcatatgtcactgcggggtaccctcaccccgatgagacggttgatattgtactgggcatg
gaggagggaggcgccgatgtcatcgaactcggcgtaccattcacagaccccatcgccgat
ggccctacgatccagcgtgcgaatactcgggcattggaacatggcgtgaccatgacctct
gtgctgaagatggtgcgcacagctagagatcgaggactgagggcacccgtgctccttatg
ggttattataacccgcttttgcggtatggcgaggaaaggctgctaaaggacgcgaaagct
gcgggtgtcaacggctttattatggttgacctgccaccagaggaagccgttcgatttaga
gatttatgcaagaaggaaggactttcatacgttcctttgattgcgcccgccacctccgat
tcccgcatgaagctactatgtaaaattgccgactcgttcatctacgtcgtgtcgaggatg
ggcgtcactggcgccaccggtcgattgagctcggggttgccagaacttctctcccgggtc
cacagttattctggcaacatacctgctgctgtaggcttcggtgttagcacgagggaacac
ttcttgagcgtacaggagattgcagagggcgttgtcattggaagccagatgatcacggtg
ctagggaacgcccctgccggacaaggcgctcaaaaggtcaaggaatattgcacaagtatt
acgggaagaaccgttgaccgaagcaagctttccgaacctcttacgcgcgaagtcggtctc
accgaagccatcactgaagcagaaaaacccactggagtgcacgtcgacagagtcatcaag
gaagcttccacttcggggccaggactcgcagaccagcttgaagctctcaacgtcactgga
gatccggctgcgataccagcgcgttttggtgagtttggcggacaatacgttccggaatca
ctaatggactgtctggcggagttggaggctggattcaacgaagccaacaacgatcccaaa
ttctgggaagaataccgctcatactatccttacatgggcagacctagcaatttacacttc
gcccaacgtttaaccgaacacgccggtggagctaatatttacatcaaacgtgaagatctc
aaccacacaggaagtcacaagatcaacaacgcgctcggccaagtgctccttgctcgccgg
attggaaagacgaggattattgccgaaacaggggccggtcagcatggtgtggctactgcg
actgtttgtgcaaagtttggcatggagtgtgttgtctacatgggagccgaggatgtccga
cgtcaagcacttaatgttttccggatgaagcttctcggtgcatctgttgtagctgtcgaa
gcagggtctcggacgctccgtgatgccgtcaacgaagcactccgcgcctgggttgttgat
ctaccaacgacgcattacgttataggctcagcaattggtcctcaccctttccccaccatt
gtgcgcacgttccagtcggtcatcggcgaagaaactaagaaacagatgaaagaactaacc
ggtcgactccccgatgcggtggttgcttgtgttggtggaggcagcaatgctgttggcatg
ttctacccgttcgcgaacgaccccagcgtcaaactcctcggtgttgaagcgggaggcgac
ggggtcgaatcagggaagcactcagcgacgctttcaggcggaaccaagggcgtcctccac
ggcgtccgcacctatgtcctgcaagatgagcatggccagatttccgagacgcattccatc
tccgctggccttgattatccgggcgttggaccggagttgagctcctggaaagatagctcg
agagccgagttcattgccgccacggatgcgcaggctctgattgggttccggacgattgct
cagctggaaggtattatcccggcgctggaatcgtcgcatgcggtgtatggagtgattgag
ctggcgaaaaagatggagaagggaaagaatatcgtgctgaatctgagcggtcgcggcgac
aaggacgtacagagtgtggcggatgcgctgcctgcgattggacccaagatcggatgggac
ttgaggttttga

DBGET integrated database retrieval system