KEGG   Uncinocarpus reesii: UREG_06522Help
Entry
UREG_06522        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ure  Uncinocarpus reesii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UREG_06522
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     UREG_06522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 515 aa AA seqDB search
MQYQTLLLLAVSAATASATYAGNLNYRSPSLNHPDLGIAVSKVVKRSDPAAAFDPAKLNF
THGVASGDPYANSVILWTRVKDKDPGHWRSPLYSPVPIYNSSDEANDYIYEYADGFYGSG
KDIGRVPLPDRTIYTLYDYRKRIATHRTDIDLVANHQRFAWIPVWDDHVLSNGAALLEVG
DNTYRDGSSLLRNVEASFLISGGVSVDQRKMNAVRAYFEWMPIRQVDMDDNLRIWRNFQI
GSLVDVLMLDTRHYDRSITDLYLNHFYVKKLKDDASRSLMGSQQENWFYRNLIKSSERGA
KWRIVGSQIVFSHIDQSAAFGKLQDFNLDAWDGYQANRNRTFKTLYDNKINNTILIAGDS
HANWVSDVAWLDHAKYDEKTGAGAIGVEFAGSSITSPSPAGSAKIDATVKKSKSLVDNNS
ILQWSELYYRGYFELHITPAEVQAKFFGTPKIRERDFSEVSLANFTVKEGANCLDRGSTG
VPGGGIVENGWLKGGKVKRTDLANNTETGQWMKVN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcaaacgctgcttctgctagccgtgtctgcggccacggcctccgcaacttac
gcgggaaacctgaactaccgcagcccttccctgaaccatcctgatctcggcattgctgtc
agcaaagtcgtcaagagatctgaccctgccgctgcgtttgatcctgccaagttgaacttt
acccacggcgtggcctctggtgatccatatgcgaattccgtcatcctctggacgcgtgtg
aaggacaaggatcccggtcactggcgcagtccactgtacagcccggtgccgatttataac
tccagtgacgaagccaatgattatatctatgaatatgccgacggcttttatggatcgggc
aaggacattgggcgtgtaccgttgccagatcgcaccatatacacgctttacgattatcga
aaacgcattgctacccaccggaccgatattgaccttgttgccaaccatcagcgctttgca
tggattccggtgtgggatgaccacgtgctttctaacggtgcggctctgctagaggttggg
gacaatacctatcgtgatgggtcgtccttgctgaggaatgtcgaagcttcattccttata
tcgggtggtgtttccgtggaccagcggaaaatgaatgcggtccgcgcatactttgaatgg
atgcccattaggcaggtggacatggatgataaccttcggatttggagaaacttccagatt
ggctcccttgtcgatgtcctgatgcttgataccaggcactatgatcgttcgattaccgac
ttatacctcaaccatttctatgtcaagaagctaaaggacgatgccagccgcagtttgatg
ggctctcagcaagaaaactggttctaccgtaatctaatcaagtcttccgagcgcggcgct
aaatggcgaatcgttgggagtcagattgttttctcgcatatcgatcagtcagctgcattc
gggaaattgcaagatttcaacctggatgcttgggatgggtatcaagccaaccggaaccgc
acgttcaagactctctacgacaacaaaatcaacaacactatcctgattgcgggagactct
cacgcaaattgggttagcgacgtggcatggttagaccatgcaaagtacgatgagaaaaca
ggagccggagccattggtgttgagtttgctggaagctcgatcacatccccgtcaccagct
ggaagcgccaaaatcgatgctaccgtcaagaagtcaaagtcgctggtagacaacaactcg
atcctgcagtggtcagaactttactatcggggttatttcgagttgcatatcactccagct
gaggtgcaggcaaagttcttcgggactcccaaaatccgggagcgagatttcagcgaagtc
tcgttggccaatttcactgtcaaagagggcgcgaattgccttgaccgtgggagcactggg
gtgcccggcggcgggatcgtggaaaacggctggcttaaagggggcaaggtaaagaggacg
gatcttgcgaataacacggaaaccggacaatggatgaaggttaactaa

DBGET integrated database retrieval system