KEGG   Uncinocarpus reesii: UREG_06574Help
Entry
UREG_06574        CDS       T01132                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ure  Uncinocarpus reesii
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UREG_06574
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    UREG_06574
   00603 Glycosphingolipid biosynthesis - globo series
    UREG_06574
   00604 Glycosphingolipid biosynthesis - ganglio series
    UREG_06574
   00511 Other glycan degradation
    UREG_06574
Enzymes [BR:ure01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     UREG_06574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 596 aa AA seqDB search
MRFFHLTALAYLLVERGHAVQVNPLPAPREIEWGTSGPRYLDWHVRFNGPGDHTIQAAWR
RAWNTITRLRWTPAVTEAPIPTFAPFPSDNEKRDALHSRGTVRNVNVKVDDTDTELQHGV
DESYTLQISEDSDKIEITAKTTWGALHAFTTLQQIVIAHHGQLLVEQPVKITDSPLYSVR
GVMVDTARNFISVRKIFEQIDGMALSKLNMLHWHLSDTQSWPLEVRSYPQMTKDAYSHRE
TLSPHDVRQVIEYGRARGVRVVPEISMPSHSASGWKQVDPDIVACEDSWWSNDVWEKHTS
VEPNPGQLDIANDKTYHVAETVYRDVSRLFTDHWFHIGGDELRTNCYKTSKHVRAWLQED
SSRTFDSLLQHWVDKIVPRLKKVNKNHRLIMWEDILLSQVMHADELPKDVIMQAWNGGLS
HIKNLTSRGHDVIVSSADFMYLDCGYGGWVGNDPRYNEMENPDPSKPTFNYLGPGGSWCA
PYKTWQRIYDYDFTDGLTDDEKKRVLGAVAPLWSEQVDDVVISYKMWPRAAALAELVWSG
NVDKNGQKRTTLMTQRILNFREYLVANGIPAAPLQPKYCLQHPHHCDLFYNQTAVV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcttccatctcactgcattggcgtatctgctggtggaacgaggacacgcagtt
caagtcaacccgctacctgctccgcgagaaatcgaatggggaacctctggaccacgatac
ctcgattggcatgtccgattcaacggccccggtgaccatacaattcaagctgcatggcgt
cgggcatggaataccattacacgactgcgatggacaccggcagtgacagaagcccctata
ccaacctttgcgcctttcccaagtgacaacgagaaacgcgatgctcttcatagccgtggc
accgtccgcaatgtcaacgtgaaggtcgacgacaccgacaccgagttgcaacatggcgtc
gatgaatcatataccttgcagatctccgaagactcagacaagattgaaatcaccgcgaag
accacctggggggctctccacgcctttactactcttcaacagattgtcattgcacatcac
ggacagctgctggttgaacaacccgtgaagattacagactctccgctctactccgttcgt
ggcgttatggttgacaccgctcgcaactttatcagtgtgagaaagatattcgagcagatt
gacggaatggccctatccaaacttaatatgctccattggcatctttcagatacccagtca
tggccactagaagtccgctcgtaccctcagatgacaaaagatgcctactctcacagggaa
actctctcgcctcacgatgtccgtcaggttatcgaatatggtcgcgctcgtggtgtccgt
gtcgtcccagaaatcagcatgcccagccactctgcttctggctggaaacaagtcgaccct
gatatagtggcgtgcgaggactcatggtggtcgaatgacgtctgggagaagcatacttcg
gtcgagccgaatcccggccaactggatatcgccaacgataagacttaccatgtcgccgag
acagtctacagggatgtcagtcggctcttcactgaccactggtttcacatcggtggtgac
gagctccggactaactgctacaagacgagcaagcatgtcagagcatggctccaagaggat
tcttctcgcacttttgactctcttctccaacactgggtcgacaagatcgttcctaggctg
aagaaagtgaacaaaaaccaccgtctcatcatgtgggaagacatccttctctctcaagtc
atgcatgccgacgagctccccaaagacgtcatcatgcaggcctggaatggcggtctcagc
cacatcaagaatctcaccagcaggggccacgacgtgatcgtttcctcggctgactttatg
tatctcgactgcggctacggcggctgggtcggcaatgatcctcgctacaacgagatggag
aacccggacccaagcaaacccaccttcaactaccttggtcccggaggctcctggtgcgct
ccatacaagacctggcaacgcatctacgactacgacttcaccgacggcctcacagacgac
gaaaagaagcgcgttctcggcgcagtggctcccctgtggtccgaacaagtcgacgacgtt
gtcatttcgtacaagatgtggcctcgcgccgccgcgttggccgagcttgtttggtctggc
aacgtggacaaaaacggccagaagcggacgacgcttatgactcaacggattctgaatttc
cgcgagtatctcgtcgctaatggtatcccggcggctcctctacagccaaagtactgtctg
cagcatccgcaccactgcgatcttttttataaccagacagcagtggtgtga

DBGET integrated database retrieval system