KEGG   Uncinocarpus reesii: UREG_06574Help
Entry
UREG_06574        CDS       T01132                                 

Definition
(RefSeq) beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ure  Uncinocarpus reesii
Pathway
ure00511  Other glycan degradation
ure00513  Various types of N-glycan biosynthesis
ure00520  Amino sugar and nucleotide sugar metabolism
ure00531  Glycosaminoglycan degradation
ure01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UREG_06574
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    UREG_06574
   00531 Glycosaminoglycan degradation
    UREG_06574
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    UREG_06574
   00604 Glycosphingolipid biosynthesis - ganglio series
    UREG_06574
   00511 Other glycan degradation
    UREG_06574
Enzymes [BR:ure01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     UREG_06574
Chaperones and folding catalysts [BR:ure03110]
 Intramolecular chaperones
  Others
   UREG_06574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 8438403
NCBI-ProteinID: XP_002583607
UniProt: C4JVI2
AA seq 596 aa AA seqDB search
MRFFHLTALAYLLVERGHAVQVNPLPAPREIEWGTSGPRYLDWHVRFNGPGDHTIQAAWR
RAWNTITRLRWTPAVTEAPIPTFAPFPSDNEKRDALHSRGTVRNVNVKVDDTDTELQHGV
DESYTLQISEDSDKIEITAKTTWGALHAFTTLQQIVIAHHGQLLVEQPVKITDSPLYSVR
GVMVDTARNFISVRKIFEQIDGMALSKLNMLHWHLSDTQSWPLEVRSYPQMTKDAYSHRE
TLSPHDVRQVIEYGRARGVRVVPEISMPSHSASGWKQVDPDIVACEDSWWSNDVWEKHTS
VEPNPGQLDIANDKTYHVAETVYRDVSRLFTDHWFHIGGDELRTNCYKTSKHVRAWLQED
SSRTFDSLLQHWVDKIVPRLKKVNKNHRLIMWEDILLSQVMHADELPKDVIMQAWNGGLS
HIKNLTSRGHDVIVSSADFMYLDCGYGGWVGNDPRYNEMENPDPSKPTFNYLGPGGSWCA
PYKTWQRIYDYDFTDGLTDDEKKRVLGAVAPLWSEQVDDVVISYKMWPRAAALAELVWSG
NVDKNGQKRTTLMTQRILNFREYLVANGIPAAPLQPKYCLQHPHHCDLFYNQTAVV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcttccatctcactgcattggcgtatctgctggtggaacgaggacacgcagtt
caagtcaacccgctacctgctccgcgagaaatcgaatggggaacctctggaccacgatac
ctcgattggcatgtccgattcaacggccccggtgaccatacaattcaagctgcatggcgt
cgggcatggaataccattacacgactgcgatggacaccggcagtgacagaagcccctata
ccaacctttgcgcctttcccaagtgacaacgagaaacgcgatgctcttcatagccgtggc
accgtccgcaatgtcaacgtgaaggtcgacgacaccgacaccgagttgcaacatggcgtc
gatgaatcatataccttgcagatctccgaagactcagacaagattgaaatcaccgcgaag
accacctggggggctctccacgcctttactactcttcaacagattgtcattgcacatcac
ggacagctgctggttgaacaacccgtgaagattacagactctccgctctactccgttcgt
ggcgttatggttgacaccgctcgcaactttatcagtgtgagaaagatattcgagcagatt
gacggaatggccctatccaaacttaatatgctccattggcatctttcagatacccagtca
tggccactagaagtccgctcgtaccctcagatgacaaaagatgcctactctcacagggaa
actctctcgcctcacgatgtccgtcaggttatcgaatatggtcgcgctcgtggtgtccgt
gtcgtcccagaaatcagcatgcccagccactctgcttctggctggaaacaagtcgaccct
gatatagtggcgtgcgaggactcatggtggtcgaatgacgtctgggagaagcatacttcg
gtcgagccgaatcccggccaactggatatcgccaacgataagacttaccatgtcgccgag
acagtctacagggatgtcagtcggctcttcactgaccactggtttcacatcggtggtgac
gagctccggactaactgctacaagacgagcaagcatgtcagagcatggctccaagaggat
tcttctcgcacttttgactctcttctccaacactgggtcgacaagatcgttcctaggctg
aagaaagtgaacaaaaaccaccgtctcatcatgtgggaagacatccttctctctcaagtc
atgcatgccgacgagctccccaaagacgtcatcatgcaggcctggaatggcggtctcagc
cacatcaagaatctcaccagcaggggccacgacgtgatcgtttcctcggctgactttatg
tatctcgactgcggctacggcggctgggtcggcaatgatcctcgctacaacgagatggag
aacccggacccaagcaaacccaccttcaactaccttggtcccggaggctcctggtgcgct
ccatacaagacctggcaacgcatctacgactacgacttcaccgacggcctcacagacgac
gaaaagaagcgcgttctcggcgcagtggctcccctgtggtccgaacaagtcgacgacgtt
gtcatttcgtacaagatgtggcctcgcgccgccgcgttggccgagcttgtttggtctggc
aacgtggacaaaaacggccagaagcggacgacgcttatgactcaacggattctgaatttc
cgcgagtatctcgtcgctaatggtatcccggcggctcctctacagccaaagtactgtctg
cagcatccgcaccactgcgatcttttttataaccagacagcagtggtgtga

DBGET integrated database retrieval system