KEGG   Uncinocarpus reesii: UREG_06645Help
Entry
UREG_06645        CDS       T01132                                 

Definition
serine/threonine-protein phosphatase PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ure  Uncinocarpus reesii
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    UREG_06645
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    UREG_06645
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     UREG_06645
Protein phosphatases and associated proteins [BR:ure01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     UREG_06645
Transcription machinery [BR:ure03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     UREG_06645
Spliceosome [BR:ure03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    UREG_06645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MADQNEIDLDSIIDRLLEVRGSRPGKQVQLLESEIRHLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFV
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKYVYGGMSTGRPITPPRKQKKK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaaaacgaaattgatttggactctatcatagatagattgttggaagtgaga
ggtagccgtcccggcaagcaagtccagctgctggaatccgaaattcgacatctttgcaca
aaggctcgggagatcttcatctcgcagcctatacttttggagctcgaagcaccaattaag
atttgcggcgatattcatggacaatattacgatcttttgcgcttgttcgagtatggcggt
tttccgccagaggccaattacctcttcttaggcgattatgtggacagaggtaaacagtca
cttgaaacaatctgccttctccttgcatacaagattaaataccctgaaaactttttcgtt
ctccgtggcaatcatgagtgtgcctcaatcaaccgtatttacggcttttatgacgaatgc
aaacgaagatacaatatcaaactgtggaagacgtttaccgattgctttaattgcttgcca
atcgctgctattattgacgagaagatttttactatgcacggtgggttaagtcccgatttg
aattcgatggaacagattcgacgcgtcatgcgccctacagatattcctgactgcggactc
ctttgtgaccttctatggtctgaccccgataaagacattaccgggtggagcgaaaacgac
cgaggcgtatcattcacctttggcccggacgttgtttcaaggtttctgcaaaagcacgac
atggaccttatatgtcgcgcccaccaggtcgtcgaggatggttacgaatttttctccaaa
cgacaattagtcaccctatttagtgcgccaaattattgcggcgagtttgacaacgcagga
gccatgatgagtgttgacgaaagccttctttgttcattccagatattgaaaccagccgaa
aagaaacaaaagtacgtctacgggggcatgagcacaggcagacccattactccccccagg
aaacaaaaaaagaagtag

DBGET integrated database retrieval system