KEGG   Uncinocarpus reesii: UREG_06694Help
Entry
UREG_06694        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ure  Uncinocarpus reesii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    UREG_06694
Enzymes [BR:ure01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     UREG_06694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 468 aa AA seqDB search
MSPFYAPWCGHCQNLKPAYEKAARSLEGLAKVAAMNCDDEANKHLCSVMRIQGFPTLRIV
VPSDKPGKPKHEDYQGARTAKGIVDAVVEKIPNHVKRLTDKDIDGWLANSNETAKALLFT
EKGTTSALLRALAIDYLGKIHIGQIRNKETSAVDTFGITKFPTLVLLPGSDKPSMVYDGE
LKKKPIVEFLKQVAEPNQDPPESAAPKAKTAKLKKPEKSTTAGTTSTSTTKAAASSDTPK
ASDGTENLKEPKIYKGSKARSKPQQTGPDLRMLSTSTDLKTTCLSSKTGTCVLAIVHVPS
DPNGLPSTHTLEALGSLAEIEHKHTLRQGRLFPFYVLPDFIDEVPTIQTALGLETGGVEI
IAINGKRGWWRRYDPSDGKNYGVVDIESWIDQVRMGEGERRKLPDGIIPSDGQKTSKQKP
KEKPKEEPATPPQNEPDPEPEQEPEATPSATPEMESQKESKTVVHEEL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtctccattctatgcaccatggtgcggccactgccagaacctaaaaccagcatacgaa
aaggcggcgaggagcctcgaaggattggccaaagtcgcggctatgaattgcgacgatgag
gcgaataaacatctctgtagtgtgatgcgtatacaaggatttcctacacttaggatagtg
gtgccatccgacaagcctgggaaacctaagcacgaagattatcaaggcgccagaaccgcg
aaaggtatagttgacgctgtcgtggagaaaatccccaaccacgtgaagcgcctcaccgat
aaggacattgacggctggttggcaaattccaacgagactgcaaaggcccttcttttcacc
gaaaagggaaccactagtgcactcttaagggctctggctattgattatctaggaaagatc
catattggccaaatcaggaacaaggagacttccgcggtggacacgtttggcattacaaaa
ttccccaccctcgttcttctccctggatcagataaaccatcgatggtgtatgacggagag
ctgaagaagaagccgattgtcgaattccttaagcaagttgcggagccaaaccaagatcct
ccagagtctgctgcccctaaagccaagacagcaaagcttaagaagccagaaaagtcgacc
accgccggcaccactagtaccagcaccacaaaagctgctgcatcgagtgacactcctaaa
gcgtcagacggcaccgagaacctgaaagaaccgaagatatataaagggtccaaagcgcgc
tccaagccgcagcaaaccgggccagacctccgcatgttatccacaagcactgatctcaag
acaacttgtctttcttcaaaaactggaacttgtgtcctcgctatcgtacatgtcccaagt
gacccgaatgggttgccgtcaacccacacacttgaagcattgggttcccttgccgagatt
gagcacaagcacaccttacgtcaaggacgccttttccccttttatgttctcccggacttc
atcgatgaagtgcccacaattcaaactgcattaggccttgaaacaggcggtgtggagata
attgccatcaatggaaaacgaggttggtggcgccgatacgatccttccgacggcaagaac
tacggtgttgttgatattgagagctggattgatcaggtccgcatgggagagggcgagagg
agaaaactcccagacggaatcattccgagtgacgggcagaagacgtccaagcaaaagcca
aaagaaaagccaaaggaagaacctgcaactcctccacaaaacgagccggatccggaaccg
gaacaagaacctgaagccacaccctcagccacccctgaaatggagtcgcagaaggaatcg
aagaccgtggttcacgaagagctatga

DBGET integrated database retrieval system