KEGG   Uncinocarpus reesii: UREG_06906Help
Entry
UREG_06906        CDS       T01132                                 

Definition
mitogen-activated protein kinase MKC1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ure  Uncinocarpus reesii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ure04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MADLQGRKVFRVFNQDFIVDERYNVTKEVGQGAYGIVCAASNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPEHFNEVYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSMDPDE
NAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILGYLGTPNEDTLRRIGSPRAQDYVRNLPYMQKVSFQRLFPNANPEALDLLDRMLAFDPS
SRISVEEALEHPYLQIWHDASDEPVCKIPFDFLHFEVVEDVHEMRKMILDEVVGFRAHVR
QTHPQVGSALPQSASQQTSVPIPEENIGAWKQDEPRPQETVHSGALPNDLEASLQGGMDA
MR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttacaaggacgcaaggtgttcagggtgttcaaccaggactttattgtggat
gaacggtacaatgtgacaaaggaagttggacaaggtgcttatggaattgtctgtgctgca
tcgaacgtacaaaccggtgaaggcgtcgctatcaagaaggtcaccaatgtcttcagcaag
aaaatccttgctaaacgtgccttgagagaaatcaaattgctgcagcatttccgcggccac
cgcaatatcacctgtctctatgatatggacattccgaggcccgaacacttcaacgaagtc
tacctatatgaagagctcatggaatgcgatcttgctgcgattatccgttctggtcaaccc
ctgaccgacgctcatttccaatcattcatctatcagatcctttgtgggctcaagtacatc
cattcggccaacgtcctacatcgtgatttgaaaccgggaaatcttctcgttaatgccgac
tgtgagctcaaaatctgcgattttggtcttgctcgtgggttttccatggacccggacgag
aatgccggctacatgactgagtatgttgctacgagatggtaccgtgctccggaaatcatg
ttgagcttcccaagctacacgaaagccattgacgtgtggtcggtcggctgcattcttgcc
gaattacttggaggacgacctttcttcaagggtcgtgactatgtcgaccagctgaatcag
atccttggatatctaggaactccaaatgaagatacccttcgccgaatcgggtctccccgt
gcgcaggattacgttcgcaatttgccatatatgcagaaagtctccttccaaagactattt
ccgaatgcgaatccagaagctctggatctccttgatcgtatgttggcgtttgatccatca
tcgcgtatctcggtggaggaggctctcgaacacccgtatttacaaatctggcacgatgca
tctgatgagccggtttgcaaaatcccgttcgatttccttcattttgaagtcgtggaagac
gttcatgagatgcgaaaaatgatcttagacgaggtcgtgggattccgagcacacgtacga
caaacacaccctcaagtcggaagtgctttgccacaatctgcatctcaacaaaccagcgtc
ccgataccagaagagaacatcggcgcttggaagcaagacgagccacgccctcaggagacg
gttcacagtggtgcgttgcccaatgaccttgaagcttccctgcaaggaggcatggatgct
atgagatag

DBGET integrated database retrieval system