KEGG   Uncinocarpus reesii: UREG_06906Help
Entry
UREG_06906        CDS       T01132                                 

Definition
mitogen-activated protein kinase MKC1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ure  Uncinocarpus reesii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ure00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    UREG_06906
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     UREG_06906
Protein kinases [BR:ure01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   UREG_06906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MADLQGRKVFRVFNQDFIVDERYNVTKEVGQGAYGIVCAASNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPEHFNEVYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSMDPDE
NAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILGYLGTPNEDTLRRIGSPRAQDYVRNLPYMQKVSFQRLFPNANPEALDLLDRMLAFDPS
SRISVEEALEHPYLQIWHDASDEPVCKIPFDFLHFEVVEDVHEMRKMILDEVVGFRAHVR
QTHPQVGSALPQSASQQTSVPIPEENIGAWKQDEPRPQETVHSGALPNDLEASLQGGMDA
MR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttacaaggacgcaaggtgttcagggtgttcaaccaggactttattgtggat
gaacggtacaatgtgacaaaggaagttggacaaggtgcttatggaattgtctgtgctgca
tcgaacgtacaaaccggtgaaggcgtcgctatcaagaaggtcaccaatgtcttcagcaag
aaaatccttgctaaacgtgccttgagagaaatcaaattgctgcagcatttccgcggccac
cgcaatatcacctgtctctatgatatggacattccgaggcccgaacacttcaacgaagtc
tacctatatgaagagctcatggaatgcgatcttgctgcgattatccgttctggtcaaccc
ctgaccgacgctcatttccaatcattcatctatcagatcctttgtgggctcaagtacatc
cattcggccaacgtcctacatcgtgatttgaaaccgggaaatcttctcgttaatgccgac
tgtgagctcaaaatctgcgattttggtcttgctcgtgggttttccatggacccggacgag
aatgccggctacatgactgagtatgttgctacgagatggtaccgtgctccggaaatcatg
ttgagcttcccaagctacacgaaagccattgacgtgtggtcggtcggctgcattcttgcc
gaattacttggaggacgacctttcttcaagggtcgtgactatgtcgaccagctgaatcag
atccttggatatctaggaactccaaatgaagatacccttcgccgaatcgggtctccccgt
gcgcaggattacgttcgcaatttgccatatatgcagaaagtctccttccaaagactattt
ccgaatgcgaatccagaagctctggatctccttgatcgtatgttggcgtttgatccatca
tcgcgtatctcggtggaggaggctctcgaacacccgtatttacaaatctggcacgatgca
tctgatgagccggtttgcaaaatcccgttcgatttccttcattttgaagtcgtggaagac
gttcatgagatgcgaaaaatgatcttagacgaggtcgtgggattccgagcacacgtacga
caaacacaccctcaagtcggaagtgctttgccacaatctgcatctcaacaaaccagcgtc
ccgataccagaagagaacatcggcgcttggaagcaagacgagccacgccctcaggagacg
gttcacagtggtgcgttgcccaatgaccttgaagcttccctgcaaggaggcatggatgct
atgagatag

DBGET integrated database retrieval system