KEGG   Uncinocarpus reesii: UREG_06976Help
Entry
UREG_06976        CDS       T01132                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     UREG_06976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 242 aa AA seqDB search
MAWQCSGSSNAQLINNLFNSGLIKSERVKNAMLRVDRADYAPANPYADSPQTIGYSATIS
APHMHGHACEYLLEYLHPGSRVLDIGSGSGYLTHVLANLITDSSSPPSSAEGHVVGIDHI
QGLVDLSKRNMAKSESGRKLLETGKVNFVVGDGRLGWLEGGPYDVIHVGAAATTIHPALI
DQLKAPGRMFIPVESTGEHSSARLFNLGGPQYIWVVDKREDGSVHKEKVFGVNYVPLTDA
PQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcttggcaatgttcggggtcaagcaatgcgcagttgatcaacaatctgtttaactct
ggtcttataaaaagcgagcgagttaaaaatgctatgcttcgggtcgaccgtgccgactat
gcaccagccaatccatacgcagattctcctcagactatagggtattcggcaaccatctcc
gctccacacatgcatggtcatgcttgcgaatatcttcttgagtatctgcatccgggatct
cgtgtgctggacatcggatctggctcgggctatttgacacatgttcttgcaaacttaatc
actgattcttcgtcgcctccatcatctgctgagggccatgttgtcggtatcgaccatatt
cagggactagtcgatttatctaagcgcaatatggccaagtctgaatctggccgcaagctg
ttagagaccggaaaggtcaactttgttgttggcgacggtcgtttggggtggttggaaggt
ggcccatacgatgttattcatgttggagcagcggcaacaacgatccatcccgccctgata
gaccaactcaaggcgcctggtcgaatgtttattccagttgaatcaactggggaacatagt
agcgctcgattgttcaacttgggtggcccgcaatacatctgggtcgtcgataaaagggaa
gatggctcggtgcataaagaaaaagtctttggcgttaactatgtgccgctgaccgatgcg
ccgcaatag

DBGET integrated database retrieval system