KEGG   Uncinocarpus reesii: UREG_06992Help
Entry
UREG_06992        CDS       T01132                                 

Definition
(RefSeq) histone H2B
  KO
K11252  
histone H2B
Organism
ure  Uncinocarpus reesii
Brite
Chromosome [BR:ure03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    UREG_06992
Exosome [BR:ure04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UREG_06992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 139 aa AA seqDB search
MAPKAAEKKPSTGGKAPAGGKAPAEKKEAGKKTAASGEKKKRTKARKETYSSYIYKVLKQ
VHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELA
KHAVSEGTKAVTKYSSSAK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaagcagccgagaagaagcctagtactggtggaaaggcgccagccggcggt
aaagcacctgctgaaaagaaggaggccggcaagaagactgctgcttccggtgagaagaag
aagcgtaccaaggctagaaaggaaacctattcttcttatatctacaaagtgcttaagcaa
gtccaccctgataccggaatatctaaccgtgcgatgtcaatcttaaactctttcgtcaat
gatatctttgaacgtgttgctaccgaggcgtcgaagcttgctgcctacaataagaaatca
acaatctcttcccgagaaatccaaacctcggtccgcctcattctgcctggtgaacttgcg
aaacatgctgtttccgaaggcaccaaagctgtaacgaaatattcttcttctgcgaaataa

DBGET integrated database retrieval system