KEGG   Uncinocarpus reesii: UREG_06994Help
Entry
UREG_06994        CDS       T01132                                 

Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ure  Uncinocarpus reesii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UREG_06994
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UREG_06994
  Amino acid metabolism
   00310 Lysine degradation
    UREG_06994
Enzymes [BR:ure01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UREG_06994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MAESISEGTLKQFSKQVGDFVERDEELATIETDKIDITVNAPESGIIKEFLAKEDDTVIV
GQDLIKVEPSTEKPAAQKEKPDETTEPAKPKAAKTQPKEQVEDVKPAHPSQRKSDVKEKD
AAPKNGQPAKDAPAPQPISTSHRNLGNRDERRVKMNRMRLRIAERLKQSQNTAASLTTFN
EVDMSSLMELRKLYKEDILKTRGVKLGFMSAFAHACVLAMKEVPAVNASIEGPNGGDTIV
YRDYVDISVAVATEKGLVTPVVRNVETMDLISIEKAIADLGQKARDNKLTIEDMAGGTFT
ISNMMYLALTYDHRLLDGREAVTFLVKVKEFIEDPRRMLLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtctatatcagaaggcaccttgaaacagttctcaaaacaggtcggggatttt
gtggagagggatgaggagctagcaacgatcgaaactgataagatcgatatcactgtgaat
gcgccagagtctgggataatcaaagaattcctggcaaaggaggacgatacagtgatcgta
gggcaagacctaatcaaagtggagccatcaacagaaaaaccagccgcccagaaggaaaag
ccggatgaaaccacagaacctgccaaaccaaaagcagcgaagactcaaccgaaagaacaa
gtggaagatgtaaagccggcccacccaagtcaacggaagtctgatgtgaaagaaaaagac
gccgcgcccaaaaatggacagcctgccaaagacgcccctgcaccccagccaataagtacc
agtcataggaaccttggaaacagagatgagcgtagggtaaagatgaaccgcatgcgacta
cgcattgcggaacgtctaaagcaatctcagaatacggcggcttcgctaacaactttcaat
gaagttgatatgtcgtcactcatggagttacgcaaattatataaagaagatattctaaaa
acgaggggtgtcaaacttggattcatgagcgcatttgctcacgcatgtgtgttggcaatg
aaagaggtcccagccgtcaatgcctcgattgaagggccaaacggaggtgatactattgta
taccgagattatgtcgacatcagcgttgcagttgcaacagagaaaggactcgtgacccct
gtggtgcgcaatgtagagaccatggatctcatttcgatcgaaaaggcaatcgcagatctt
ggacaaaaggctcgagacaataagctaacaatcgaagacatggctggtggcacattcacg
atcagtaatatgatgtatctagctttgacctatgatcatcgcctccttgacgggagagaa
gccgtcaccttcttagttaaggtcaaggagttcatcgaagacccaaggcgcatgttgcta
gcgtaa

DBGET integrated database retrieval system