KEGG   Uncinocarpus reesii: UREG_07082Help
Entry
UREG_07082        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ure  Uncinocarpus reesii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UREG_07082
Enzymes [BR:ure01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     UREG_07082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 939 aa AA seqDB search
MPFKPFKPPLIRKPPNVPAQRLSSESDHQHATKRRRISDDSIDLTEEKAKPEVSVEITQQ
ATKLGSSYRKPLTLVNNSHHVPEKLGQHGVKADDDGGTEAYYNVLWRKFTAKKHKTWDGD
GILTLRGGYAYLQDISGRDMGRMMFNSTLEPGSMLSVGGKDVEVESLLSKEEYLSGRPFL
SVNKSTTGTTSKKQPELPRMAPVHISRSTSISGSKPINFATKLKVDRKTADEVAPKTLNV
AAPKSMAMNNAFKNPLKEDTVLPSKPNNVPTPRHDPNQPGAIVMKRPTSVPKEKQLVDVV
IDPLLGKHLREHQREGVKFLYECVMGMRPFNGEGAVLADEMGLGKTLQTIALLWTLMKQN
PIHEAPPVVKKALIVCPVTLIKNWQKEFKKWLGNDRLGVFVADGKHMRLTDFTMGMSYNV
MIIGYERLRTVQEELTKGRGIDIVIADEGHRLKTVQNKSAQAIQSLNTARRIILSGTPIQ
NDLSEFFAMVDFVNPGLLGTFKMFMKEFEGPIVKSRQPGASRKEIEKGKARSEELASLTS
LFILRRTADILLKHLPPKTEYILFCNPTPAQANIYRHVLASPIFQSALGNSETENSNSTI
SSLLSTLPPNLLRHFSPASSGKIRVLDQLLHNLRSTTSEKVVLVSNYTSTLNLLAALLTS
LALPFLRLDGSTPANKRQYLVDDFNRSSSSSCFAFLLSAKAGGIGLNLTGASRLVLFDVD
WNPATDIQAMARIHRDGQKRHCHIYRMLLRGGLEEKIWQRQVTKIGLADSVMDQKGGIAH
FSREELRDLFRLDEETECQTHELLACECGGRGRNAHIADEEAIDNAGTLADSDSITGDSD
DSAESSDMPALRKASELSIQPSEHKSKRAIKKRNAKMRYLMQYSHIDTSLLNSDHRKAIK
EQIADEVLWSLLQDEGNGVRYMFKRDGFADLAADPTAVR
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgccattcaagccctttaagccgccgcttattcgaaaaccacctaatgtcccagcgcag
cggctaagctcagagtccgaccatcagcacgcaacgaagcggcgccgcatcagcgacgat
tcgatcgatttgaccgaagaaaaggcgaagccagaggtctcagtggagataactcagcag
gctacaaaactcgggtctagctaccggaaaccgttgacgttggtgaataattcgcatcat
gtacctgagaagcttgggcagcatggagtcaaggctgatgatgatggcgggacggaagcc
tactataatgttctttggcggaaatttacggcaaagaaacataaaacctgggatggtgat
gggattttgaccctacggggcggctacgcctatctccaagatatctcgggacgggacatg
ggacgaatgatgttcaattctacactcgaaccgggctcgatgttatcggttggtgggaag
gatgtggaagttgaatcgctactctccaaggaagaatatctgtccggtcgcccatttttg
agcgtgaacaagagcaccaccggcaccacatcgaaaaagcaacctgaattgccacgaatg
gcgccagttcatatttcgcgcagcacttctatatctggttctaaacctattaatttcgct
acgaaacttaaggtagacagaaaaacagccgacgaggttgccccaaaaacgctcaatgtg
gcggcaccgaagagcatggcaatgaacaacgctttcaagaatcccctgaaagaagatact
gttttgccgtcaaagccgaataacgttcccaccccacgccatgacccgaatcagccgggc
gcaatcgtaatgaaacgtcccacatcagttccaaaggaaaagcagcttgttgatgttgtt
attgaccccctcctgggaaaacatcttcgagagcaccaacgtgagggggtcaaatttctt
tatgaatgtgtaatggggatgcgtcctttcaatggcgaaggtgccgttcttgcggacgaa
atgggcttagggaaaaccttgcagacgattgctttactttggactttaatgaagcagaac
ccaattcatgaggcgccaccagttgtcaaaaaggctctcatcgtgtgtccggttacactt
ataaagaattggcaaaaggaattcaaaaaatggctaggaaatgatcggcttggtgtgttt
gttgcggacggaaaacacatgagactgacggactttacgatgggaatgagttataacgtg
atgattatcggttatgaaagactgcgtacagtacaagaagagctaaccaagggtcgcgga
atcgatatcgtcattgcggatgaagggcataggttgaagactgttcagaataaaagtgcc
caagcaatacagtcgcttaataccgctcgacgcattatcctttccggaacaccgattcaa
aacgacttgagtgaattctttgcaatggtggatttcgtcaatcctgggctcctaggcact
ttcaaaatgtttatgaaagagttcgaaggacctatcgtcaagtctagacaaccaggggca
tcgagaaaggagattgaaaaggggaaagctaggagtgaggagctagcaagtctaacgtcc
ttgtttatcttgcgccggaccgcagatattcttttgaagcacctcccccctaaaactgaa
tatattctgttttgcaacccgactcccgctcaggccaatatataccgacatgtactcgcc
tctccgatatttcagtcagcacttggaaactcggagactgaaaattcgaactctacaatt
agctccctcctatcgacgctccctcctaaccttcttcgacacttttcacccgcgtcgagt
gggaaaattcgcgttctcgatcaactcctacacaacttacgcagtactacatctgaaaag
gttgtgctggtgtcgaactacacgtcaaccctcaaccttcttgccgccctcctaacttct
ttagcccttccatttctgcgtctcgacggttccaccccagctaacaagcgccaatacctc
gttgatgatttcaaccgttcatcttccagttcttgcttcgcatttcttctctccgcaaaa
gctggtggaattgggctcaatctcacgggcgccagtcgcctagttctttttgacgtagac
tggaatccggcaacagacatccaagccatggcacgaatacatcgtgatggacagaagaga
cactgtcacatttaccggatgttgctcagaggaggactagaggaaaagatctggcagaga
caggtcaccaagatcggtctagcggatagcgtgatggaccagaaaggtggtatagcgcac
ttttcaagagaagaactgcgagatctattcagattagatgaagagacagaatgtcaaaca
catgaacttctggcgtgtgagtgcggtggacggggcagaaatgctcatatagcagatgaa
gaagccattgacaatgccggaaccttagccgattccgacagcattactggagatagtgat
gattcagctgaatcctcagatatgcccgcactcagaaaggcatccgaactatctattcaa
ccctcagaacacaagagcaagcgcgccattaaaaagcgaaacgcgaaaatgcgctatctc
atgcaatattcccatatcgatacatctcttctcaactccgaccatagaaaggctataaag
gaacagattgccgacgaagtactctggtcgttacttcaagacgaaggaaacggagtgagg
tatatgtttaaaagggatggatttgcggatctggctgcagatccgaccgctgttcgatag

DBGET integrated database retrieval system