KEGG   Uncinocarpus reesii: UREG_07217Help
Entry
UREG_07217        CDS       T01132                                 

Definition
pentafunctional AROM polypeptide
Orthology
K13830  
pentafunctional AROM polypeptide [EC:4.2.3.4 4.2.1.10 1.1.1.25 2.7.1.71 2.5.1.19]
Organism
ure  Uncinocarpus reesii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ure01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ure00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1580 aa AA seqDB search
MATPTVIKILGRDSIVADPGIWKRHVAQDLLTNCPSSTYILISDTTLTPLYVPSFQQAFE
AAASSVTPKPRLLTYAIPPGEVSKSRQTKAEIEDWMLSRQPPCGRDTVIIALGGGVIGDL
IGYVSATYMRGVRFVQVPTTLLAMVDSSIGGKTAIDTTHGKNLIGAIWQPEKIYLDMEFL
NTLPEREFINGMAETAAISSEEDFAALERNADAILAAVKSENTTERPRFSGIQEILKLTI
LASARFKADVVSKDEREGGLRNLLNFGHSIGHAIEGILAPQILHGECVAIGMVKEAELAR
HLGILKSVAVSRLVKCLASYGLPTSLKDSRVRRLSAGKHCSVEQLLAFMAVDKKNAGPMK
KVVLLSSIGSTHEQKASVVSNKDIKIVLAPSIEVSPGVPHALEITCVPPGSKSISNRALV
LAALGSGTCRIKNLLHSDDTEVMLSALERLGAATFSWEEEGEVLVVHGKGGRLQASPDAL
YLGNAGTASRFLTTVATLANKSTVDSTILTGNARMKQRPIGALVDSLRTNGAGIKYMETT
GCLPLKIDASGGFAGGHISLAAKVSSQYVSSLLMCAPYAKEPVTLKLVGGKPISQPYIDM
TTAMMRSFGIDVKKSTSEEHTYHIPQGRYMNPTEYIIESDASSATYPLAVAAITGTTCTI
PNIGSKSLQGDARFAVDVLRPMGCEVNQSSFSTTVTGPRNGALNALPNVDMEPMTDAFLT
ASVLAAVATAGSTSTTRIFGIANQRVKECNRIKAMKDELAKFGVTCREHEDGLEIDGIDR
SALLRLPHGVYCYDDHRVAMSFSVLSLAASHPTLILEKECVGKTWPAWWDTLAQLFKANL
EGVELKSEKKKAEKPAASLFIIGMRGAGKTTSGLWASKVLKRPFIDLDVELESKLGKSIP
EIIKEQGWEGFRANELALLRQVLSEKPTGYVFACGGGIVETEEARDLLTQYQKAHGNVLL
VMRDINAVMDFLKIDKTRPAYVEDMMGVWLRRKPWFQQCSNIQYYSQQSDPSKMGSALES
FSRFLRVVTGEVDHLALMKKKPQSFFVSLTLPDLRPSVDILNDITLGSDAVELRVDLLVD
PSSSSEMPSVDYVAEQISILRSRVSVPLVFTIRTKSQGGRFPDDAHNAALDLYRLAIRMG
SEFVDLEVTFPEYVLRAVTEMKGVSKIIASHHDVANRLSWRNGSWTQFYNKALQYGDIIK
LVGIASQLDDNIALREFKIWAKKAHDIPVIAINMGERGRLSRILNGFMTPVSHPKLPFKA
APGQLSAKEIREGLSLMGEIESKKFAIVGKPISASRSPALHNALFADVGLPHVYGRLETD
DVQNVKDLIHAPDFGGASITIPLKLDIMPLLDEIAPEAKVIGAVNTIVPAPREPGDVKKG
PRLIGYNTDWQGMVQCLRHGGAVSPSTSNDPAPGLVIGGGGTARAAIHALHSMGYSPIYL
VGRSESKLNDMALSFPATYNLQILKDAESLEILPSVAIGTIPGDQPIDPSMREVLCRLFE
MAARIDAELKELAPKRVLLEMAYKPTVTPLSQLASDCGWATIPGLEALVGQGVYQFQLWT
GITPVFRDARAAVMNADADI
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atggctactcccacagtgatcaaaatcctaggtcgggacagtatagttgccgatcctggc
atttggaaacgccatgtcgcgcaagatttattgacaaattgcccttcttcgacctatatc
ctcatctccgatactactttgactcctctatacgttccaagctttcagcaagcgtttgaa
gctgcagcctcgagcgtgacgccaaagccacggcttctcacttatgcgatccctcccgga
gaagtttccaagtctcgtcagacaaaagcagagatcgaagactggatgctaagtcgccag
ccaccatgtggtcgcgataccgtgataattgctcttggtggtggtgttatcggggatctc
atcggctatgtttctgcaacctacatgcgtggagtccgttttgtacaagtgccgacgaca
ttgctagcgatggttgactcttcgattggtggaaagaccgcgattgacaccactcatggg
aagaacttaattggtgccatctggcagccagaaaaaatctacctagatatggaatttttg
aacactttacccgaaagagagtttataaatggaatggctgaaactgcggctatatcaagt
gaagaagactttgctgcgttggaacggaatgcagatgctattctcgccgccgtgaaatcc
gaaaatacaactgagcgtccccgattcagtgggattcaagagatattgaaactaacaatt
ttagcatccgcaaggttcaaggccgacgtcgtttcgaaagacgaaagggaaggcggacta
cgaaatcttctaaactttggtcattccattggacatgctattgaaggcatacttgcccca
cagatccttcatggagaatgtgtggcaataggcatggttaaagaagcggaattggcgcga
catctcgggattctcaaaagtgttgcggtgtctcgcctcgttaaatgtttggcaagttac
gggctgccaacatccctgaaggactcacgggtaaggcggctaagtgctgggaaacattgc
agtgttgagcaactccttgcattcatggctgtcgacaagaagaatgctggacccatgaaa
aaagtcgttctcctctcctctattggcagcacccatgagcagaaggcaagcgtggtatct
aataaagatatcaaaatcgtgctagcaccgagcatcgaagtctctcctggcgtgccccac
gcactagaaatcacatgcgtccctccaggctcaaaaagcatctctaatcgggctctagtt
cttgccgcccttggctctggtacctgtcgtatcaagaatcttcttcattcagatgataca
gaggttatgcttagtgctctcgaacgcttgggggctgcaacattttcgtgggaggaagaa
ggcgaagttcttgtcgttcacggcaaaggaggtagattgcaagcaagtccggatgctctt
tacttgggaaatgctggaacggcctcaaggttcctcacaactgttgcaactctcgccaac
aaaagcaccgttgactccaccatccttacaggaaacgcacgaatgaagcaacgaccaatt
ggtgcccttgttgattctctgagaactaacggtgcagggatcaaatacatggagaccact
ggctgccttcccctaaagattgatgcgtcaggtggatttgcaggcggacatattagccta
gcagcgaaggtttcctctcagtatgtgtcatctttactcatgtgcgccccgtatgcgaag
gagcccgtaactttaaagctcgttggcggcaaaccgatttcacagccctacattgacatg
acaaccgctatgatgcggtcgtttggcatcgacgtaaaaaagtctacttcggaagaacat
acatatcatattccgcaaggcagatacatgaacccgacggaatacatcatcgagagcgac
gccagctccgcgacataccctttggccgtcgctgcaatcacgggcactacctgtactatt
cccaatattggttcaaaatccttacaaggagatgcacggttcgcggtggacgttttgaga
cctatgggatgcgaggttaatcagtctagcttctcaaccaccgttaccggtcccaggaac
ggagcattaaatgcattgccgaatgtcgatatggaacccatgacggacgctttcctaacg
gcctccgtccttgctgccgtggcaacggctggttcaaccagtacaacaagaatatttggt
attgccaaccaacgcgttaaagagtgtaaccggatcaaagcaatgaaggatgaactggca
aaatttggggtaacttgtcgagaacatgaagacggcctcgagattgatggcatcgatcgt
tccgcgctattgcggctgccgcatggagtctattgctacgacgatcaccgggtagctatg
agctttagcgttctctcccttgcagcatcccaccctactttgatccttgagaaagagtgt
gtgggcaaaacttggcctgcttggtgggatacattggcccagctcttcaaagcaaacctt
gaaggtgtggaactaaaatctgaaaagaaaaaggcagagaaacccgcggcctcattattc
attattggcatgagaggagcaggcaaaacaacaagcggcttatgggcatcgaaggttttg
aaacggccatttattgaccttgacgtggagcttgaaagcaaactgggtaagagcatacca
gagattatcaaagagcaaggctgggaaggtttcagggccaatgaacttgctctcttgcgg
caagtattaagcgaaaagccaacaggatatgtatttgcttgcggcggtggaatcgtcgaa
acggaagaggcccgtgatctcttgacacagtaccaaaaggcccatggcaacgttcttcta
gttatgcgagatatcaacgcagttatggactttttgaagattgacaagacacggccagct
tacgttgaagatatgatgggcgtgtggctgcgtcgaaagccttggttccaacaatgcagc
aacatccaatattacagccagcagagcgacccgagtaaaatgggttccgccttggaaagt
ttttcacggtttttaagggtcgtgaccggagaagtggaccatctcgcccttatgaaaaag
aagccacagtcctttttcgtttcattgactctcccagacctacgcccgtcggtagacata
ttaaacgacatcacacttggttcagacgcagttgaattgcgcgttgacttgctcgtggac
ccgtcttctagcagcgaaatgccctctgttgactacgttgctgagcagatttccattctc
cgcagtcgtgtgtctgttccgctcgtgtttacgatccgaaccaaaagccaaggcggccgg
ttccctgatgacgcacacaacgctgctttggacttgtaccgacttgctattcgcatgggt
tcagagtttgttgaccttgaagttacattcccggaatacgtcctacgtgccgtaactgaa
atgaaaggtgtttccaagataatcgcatctcaccacgacgttgctaaccgactatcgtgg
agaaatggatcttggacacagttttataacaaagctttgcagtatggagatattatcaaa
cttgtcggcattgccagtcagctagacgacaatatcgccctcagggaattcaaaatttgg
gcaaagaaagcccacgatattcctgtgatcgctatcaatatgggcgaaaggggtcggctc
agtcggatcctgaacggcttcatgacacccgtgtctcacccaaaacttccgttcaaagct
gcgccgggtcaactttccgcaaaagaaattagagaagggctttctctaatgggtgagatc
gagtcaaagaaatttgctatcgttggaaaaccaatatctgcgtcgagatcccctgcattg
cacaatgctttgtttgcagatgtcggtttaccccatgtgtacggccgtttggaaaccgat
gatgttcagaatgtcaaagatttaattcacgcacccgattttgggggcgcctctatcacg
atccctctcaaactcgacatcatgccgttgctagatgaaattgcgcctgaggctaaagtc
attggagccgtgaacactatcgttccggccccaagggaaccaggcgacgtaaagaagggt
ccacgcctgatcggctacaatactgactggcagggcatggtccaatgtctccgtcacggc
ggagcagtctctccgtcaacctcaaatgacccggctcccggcctcgtgatcggtggcggc
ggtaccgctcgtgccgccattcatgctcttcacagcatgggttattcccccatttacctt
gttggccgctcggagtccaaactgaatgacatggcgttgtcatttcccgcaacatataat
ctccagatccttaaggacgcagaatcactggaaatcctcccttcagtggctatcggcacg
attccgggtgaccaaccaattgaccctagcatgagggaagttttgtgccggttattcgaa
atggctgcacgtattgatgccgaactcaaagaattggcacccaagcgagtcttgttggag
atggcatataaacccactgtgacaccgttgagtcagttagctagtgactgcggttgggca
acgatccccggcttggaggctctggttggacaaggagtgtaccagttccaactttggact
ggaatcacaccagtttttcgagacgcaagagccgcagttatgaatgctgatgctgacatc
tga

DBGET integrated database retrieval system