KEGG   Uncinocarpus reesii: UREG_07416Help
Entry
UREG_07416        CDS       T01132                                 

Definition
(RefSeq) hypothetical protein
  KO
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
ure  Uncinocarpus reesii
Brite
Enzymes [BR:ure01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UREG_07416
Peptidases [BR:ure01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UREG_07416
Ubiquitin system [BR:ure04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    UREG_07416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 609 aa AA seqDB search
MPEKPATIAAYAAGASLAAITLFYVFGPNFTIDGDESNISGRKKTIVGLSNPANDCFINS
VLQALAGLGDLRLYLIRELHRRELEGRGVYESYPDPEDVPRDRTPEGVRQLQQAPVTKAL
KEMLDRLNERPIYRKTISARGFIQALESAFRTRISRTQQDAHEFLQVVAERLCDEYHAGD
KARKRAGALLTVPSGVPELELDPEKLQIPPASVTDVDSEDASMIGSRWRETSREEHGFPL
EGMLESQVECQFCHYKYKPNQTSFVNLTLQVPQKSSTSLSACFDGLLKTEYIEDFRCDRC
QLIYTLDLKLKAQQRAVSEREKQAIRAEISLLRAAIDGDPEVPLEGVTMPDAQSIPKRKI
ARHMRVTKFPRLLAIHLSRSIFDQSASTKNAAKVAFPERLPLGGILNRKWYRLLGIVCHK
GSHHSGHYESFRRNVVYAPFSTPDAFRSYAQSRAASENPSTMPSPRMHTMHRPSDAELSP
LTISDSSSASVSTSSLPAPSPSLNQRSPLSSASIDRLPSISSATRIPPRSSPASAVSSNK
PESGSKGPGKPSSGDASLFRRKKRQNERWWRISDERVKECKTSDVLGMQREVYLLFYEME
RPGDDPSTA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaaaacctgcgaccatagcagcttacgctgcgggggcctcgctcgcggctatc
accctcttctacgtcttcggcccaaacttcacgatcgacggcgacgagtcgaatatcagc
ggcagaaagaagactatcgtcggcctctcgaaccccgccaatgattgctttatcaattcc
gtactgcaggcgctcgccggactgggagacctgcggctgtacctgatacgagagctacat
cggagggagctagagggaaggggagtctacgaaagctatccggaccctgaagatgtgccg
agggaccggacgccggagggtgtgcggcagttgcagcaggcgccggtgactaaggcgcta
aaggagatgttggatcgacttaatgagaggccgatttatcgaaagacgatttcggccagg
gggtttatacaggcgttggagagtgcgtttcggacgaggatcagtcggacgcagcaggat
gcgcatgagtttttgcaggtggtggcggagcgactgtgtgatgaataccatgccggggat
aaagcgcggaaaagagccggggcgctgctcacggtgccttcgggggtccctgagttggaa
ttggatccggagaagctgcagattccgcctgccagcgtcacggatgttgattcggaagat
gcgtcgatgatcggttcacggtggagagagacaagtagagaggaacatgggtttcccttg
gagggaatgctggaatcacaggtcgaatgccaattctgccactacaaatacaagccgaac
cagacgtcgtttgtcaaccttacattgcaggtgccgcaaaaaagctccacctctctgagt
gcttgcttcgacgggctgctgaagactgagtacattgaagatttccgatgcgacagatgc
caattgatttatacactagatctcaaactgaaagcgcagcagcgtgcggtttctgagcgg
gaaaagcaggcgattagagcagaaatatctctccttcgagccgcgatcgacggtgacccg
gaggtgcctctagagggcgtcacaatgcccgatgcgcaaagtataccaaaacggaaaata
gcacggcacatgagggtcaccaaattcccaaggcttcttgcgattcacctatccaggtcc
atatttgatcaaagcgcgtcgacgaagaatgccgccaaggtggcattcccagaacgttta
ccgttaggcggcatactcaatcggaaatggtacaggctgttggggatcgtgtgccacaag
ggaagccatcacagtggacactatgaatctttccgacgaaatgttgtgtacgcgccgttt
tcaactccagatgcgtttaggtcctacgcccagagcagagcggccagcgagaatccatcc
accatgcccagtccgaggatgcacacgatgcataggccgtctgatgcagagctaagccca
ctgacgatatccgattcgtcctctgcttcggtgtctacctcctcactgccggcgccgtcg
ccatccctgaaccagagaagcccgctctcatcagcgtccatcgacaggcttccctccatc
tcatcagcgacgcggatcccaccgaggtcatcaccggcatccgcagtctcgtccaacaaa
cctgaatcaggctccaaggggcctggtaagccatcatccggtgacgcatcgcttttccga
agaaagaagcgtcaaaacgaacgctggtggaggatcagcgacgaaagggtcaaggaatgc
aagacaagcgatgtcttgggaatgcagcgagaggtgtatttgttgttttacgaaatggaa
cggcccggcgatgatccttctacagcatga

DBGET integrated database retrieval system