KEGG   Uncinocarpus reesii: UREG_07638Help
Entry
UREG_07638        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ure  Uncinocarpus reesii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ure00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    UREG_07638
Enzymes [BR:ure01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     UREG_07638
Peptidases [BR:ure01002]
 Metallo Peptidases
  Family M67
   UREG_07638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MIPPLNVAEIARQAAEYDFDPAVKLHYWLRTATSLAAVYEREGNDQQAYLLLFRHAQLVL
VNVIRHPQAIDPAYRRGVAEARREVQHSLERLEILKPRINQRYEQYIQGLRDNESRQTPA
SQLRNEVATSRRPEALDPAIAGRALPLAAAENKDLAVKLAQTELRRRAAAKLGRYLNEGY
HSRQQHKTAPYGQDQGDDGTDGDDLAGRLREVRARVEQDQSYNRRALPFQATRDQAPSRR
PDLNHSTTTYRYPAVPGQSSFSITETIPPVPSKELVQPLPLQPPTPPAKLPELPSDTIPI
PPAAGPPIPGKIAHTTTDTLSPEPTRQSNNISPSSSDLQPSTFTFKPSSYLENGTPLRTI
FISPDLRKGFLEIARPNTLRNLETCGILCGSLISNAFFISKLLIPDQESTPDTCEMINEA
AVFEYCDAEDLMVLGWIHTHPTQTCFMSSRDLHTQSGYQVMLAESIAIVRCWRVRRVDCF
TRMGRRISTRMR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcctctcaacgttgcggagattgctcgccaggccgcagagtatgactttgac
cccgccgtgaagctgcactactggctcagaacggctacatcgctggcagccgtctacgaa
cgagaaggaaatgaccagcaggcatacctgctgctcttcaggcacgctcaactcgtcctc
gtcaatgtgatcagacacccgcaagccatcgatccagcctatcgacgcggtgtagccgaa
gcgcggcgggaagtgcagcactccctggagcgattggaaatcctcaagccccggatcaac
cagcgttatgaacagtatattcagggccttcgcgacaacgagtcccggcagactccagcc
tctcaactgcggaatgaagtggctacgtcgcgcagacctgaggcccttgaccctgctata
gccgggcgagcattgccccttgccgctgcagagaataaggatttggctgtgaagcttgcg
caaacggaattgagacgaagagcggcggccaaactagggcgatacctgaatgagggatat
cactcgcggcagcaacacaaaacagcgccgtacggtcaagaccagggggatgatgggaca
gatggagatgacctggctggacggcttcgagaagtgcgggccagagttgaacaggatcag
tcgtataacagaagagcactacctttccaggctactcgagaccaggctccgtcgcgcagg
cctgacttgaaccattcgacgacgacctatagataccctgccgttcctggacaaagctcc
ttcagtatcactgaaacaatcccacccgtccccagcaaagagctcgttcaaccgcttccg
ctacagcctccaactcctcccgccaaactccccgaactcccctcggacactatccccatc
ccgcctgcagctggaccaccaattcccggcaagatcgcacacaccaccaccgacaccctc
tcccccgagcccactcgccaaagcaacaacatcagcccatcctcttcagacctccagccc
tccacattcaccttcaaaccgtcatcctacctcgaaaacggcacccccctccgcaccatc
ttcatctcccccgacctccgcaagggcttcctcgaaatcgcccgccccaacaccctccgc
aacctcgaaacctgcggcatcctctgcggctccctcatctccaacgccttcttcatctcc
aagctcctcatccccgaccaggaatccacccccgacacctgcgagatgatcaacgaagcc
gccgtcttcgagtactgcgacgccgaagacctcatggtcctcggctggattcacacccac
cccacgcagacgtgcttcatgagctcgcgcgacctgcacacgcagtcgggctatcaggtc
atgctggcggagagcatagcgatcgtacggtgttggcgtgtacgcagagtggattgtttc
acccgcatggggaggcggatatctacacggatgcgctga

DBGET integrated database retrieval system