KEGG   Uncinocarpus reesii: UREG_07696Help
Entry
UREG_07696        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ure  Uncinocarpus reesii
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ure00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    UREG_07696
Enzymes [BR:ure01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     UREG_07696
Protein kinases [BR:ure01001]
 Serine/threonine protein kinases: Other group
  TTK family
   UREG_07696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 860 aa AA seqDB search
MTLDTSPTPLPAGQRRTAYNPQLTSIHDLHRRTVSRHMVSHGSPNGVPVESGTRSEDMAR
PRAFSAGDSSDDDDFPEPIKFSAAAKALLEEGVSGLDTSPRRSPRGVIEGEGYQTDQVRR
QQGKHVRIASPGQRMSASPSLRIVRLASESRRSPSSLGKESSFMSNRGEGGYDGSMGTGN
DFVTPAPRTRSVRIATGSRSTTRSTSASILSANGGSSSDASRIDERSLLEEGVKTGLDER
SCVRSGMGTVPRVRGEVDTGVHGSLRVKRVGKLPGSFLNGPARRGVPRRQSEEETHPEYQ
EESYLNPEPHARYGEGQVPISRLGDSMLRGDAPFERRRESPRLSDHNMVGSASAMTPRSI
PIRERSHQKENGSSALKNGSPLPLNHLKSSSGSRHSGSPKSFTDSQPEYRAPRPVELPAK
NDQENGAPSTFKTSRPHGFGSLNDKVSVLYEGNKSSNSKPPPETVSPRKPLGKMSNNTPR
RPAPLPPPKMSVLETATAVAGAATSKKKRAQVSVNRKTYTRMDCIGRGGSSRVYRVMAEN
CKIFALKRVNLEDVDPSALIGYKGEIDLLKKLRNVERVVQLYDWEINEEKRALSVLMEMG
ESDLHEILKFKLNAEDAAFDPVLTRFYWKEMLECVQAVHDFDIVHSDLKPANFLLVRGKL
KLIDFGIANTIQDHTVNVHREQQTGTPNYMAPEALIDCNAMSGLPATAGKMMKLGKPSDV
WSLGCILYLMVYGKPPFAHITKLLERIMSIPNPKVPINYPPVGVGNIPVPPSILRTLKGC
LQRDQTLRPTIKQLLGRNDPFLYPEAHLQGTVPISQEMLGRILSNVVNHCRARGTPTDEE
LAGWPSGFFAKIQAAMQADG
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgatacttcgcccacgccattgcccgcaggccagcgaaggacggcttacaat
ccgcaattgacttcgatacacgacctccatcgcagaaccgtatcaaggcatatggtctcc
cacggatcaccaaatggcgtgcctgtagaatctgggacgaggtctgaggacatggcgcgc
cctagagcattctcagcgggtgatagctcggatgatgacgacttccccgaaccgattaaa
ttcagtgctgccgcgaaagcgttgctagaggagggtgtgtcggggttagatacgtcgccg
agacggagcccacggggtgtgatagaaggcgaaggatatcaaacggatcaagtgcgacga
cagcaggggaaacatgtcagaattgcatcgccaggacagcggatgagcgcgagtccgtcg
ttaaggatagttcgtcttgcttctgagtctcgacgctcgcccagctcattaggaaaggaa
tcttcgtttatgtcgaatagaggagagggtggatatgacgggtcaatgggaactgggaat
gatttcgtcaccccagcaccaaggacaaggagtgtgaggatcgcgaccggctcaaggagt
acgacccgttcaacgtctgcatcgattctatcagccaatgggggctcctccagtgatgct
agccggattgatgagaggtcgttattagaggaaggagtgaaaacaggccttgatgaacga
agctgtgtgcgaagcggaatgggtaccgtgccccgggtaaggggggaagttgacactgga
gtacacggctctctacgagtgaagcgagtgggtaaactgccagggtcttttcttaacgga
ccggccaggagaggcgtgccacggcggcagagcgaggaagagacgcatccagaataccaa
gaagaatcgtatctcaatcctgaacctcacgccagatacggagaagggcaggtgccaatt
tcgcgcctgggagattcgatgctacgtggcgatgcgccttttgaaagacggcgggaatcg
ccacggctctcagatcataacatggttggctcggcgtcagcgatgacccctcgatccata
ccaatcagagaacgatcgcatcaaaaggaaaacggcagcagtgccttgaagaacggctct
cccctacccctaaaccatctcaagtcctcgtctgggtctcgccatagtggctcacctaaa
tcatttactgatagccaaccagagtatcgcgctccccggcccgtcgagttaccagccaaa
aatgaccaggaaaatggcgcgccgtctacgttcaaaacctcaagacctcatggtttcgga
tcattaaacgacaaagtgtcggttttgtatgaggggaacaagagtagcaacagcaagccc
ccaccggagacagtatccccacgaaagccgctaggaaagatgagcaataatactcctcgc
cggcctgcgccgctcccaccacctaaaatgagtgtgttggaaacagctactgctgttgca
ggcgccgccacatccaaaaaaaagcgagcacaagtatccgtcaatcgcaaaacctataca
cgaatggattgtattggacgtggcggaagttccagagtttatcgcgtgatggcggagaat
tgtaagatatttgcgcttaaacgggtgaaccttgaggacgttgatccctcagctttgatt
ggatataaaggggagatcgatcttttgaaaaagctacgcaatgtcgagcgtgttgttcag
ctctatgactgggagattaacgaagaaaagcgcgccttgagcgttctgatggagatggga
gagtcggatcttcacgaaatcctcaagtttaaactaaatgccgaagacgctgcttttgat
ccggtcctcacccgattctactggaaggagatgctcgaatgcgtccaagctgtgcatgat
tttgacatcgttcactctgatctcaagcctgccaatttccttctcgtccgaggcaaactg
aaacttattgattttgggatcgcgaatacaattcaggaccatacggtcaatgtacatcgc
gaacagcaaacaggaaccccgaattacatggcccccgaagcactcattgattgcaacgca
atgtcgggtctacccgccactgctggcaagatgatgaagttggggaagccgagcgacgtg
tggagccttggatgtatactgtatttgatggtctatgggaaacctccttttgcacatatc
acgaaactcctcgaacggatcatgtcgattcccaatccgaaagtgcccatcaattatcct
cctgttggagtgggaaatattcccgtcccaccatcaatattgcgaactttgaagggttgt
ttacagcgcgaccaaacgttacggcctacaataaagcagttgctcggccgcaatgatcca
tttttatacccggaggcgcatctccaaggcacagtgcccatatcacaggagatgctaggt
aggatattaagcaatgtggttaatcattgtcgtgctcggggaaccccaacggatgaagaa
ctagcaggttggccgtcgggattctttgcgaagatccaagctgccatgcaagccgacggg
tga

DBGET integrated database retrieval system