KEGG   Uncinocarpus reesii: UREG_07862Help
Entry
UREG_07862        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ure  Uncinocarpus reesii
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ure00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:ure00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 411 aa AA seqDB search
MTLKALSVGFFLSQVLAVPAPRVDADAIPFRIPPSAASSIPEAQSQLDGLASFAYGVTKS
NLESGSERRRTNACTLSNLSVRREWSTFTVRQRKAYIDAVLCLQKLPAKTPSSIATGAKS
RYDDFVATHVQQTLGIHHTGTFLAWHRYYVHEYDQALRNECSYKGDYPYWDWPLSAVIGM
ENHPIFDGSDTSLSGNGKPIPNQGDIVVRIADFPPVNLPSGTGGGCVTSGPFKDYVVNLG
PAVLLLPGDKVEFRPNPLDHNPRCLKRDLTDTVIKKYANATAVVDLILRSKDIESFQTTM
QGALGSDSVGVHGGGHFALGGDPGRDVFVSPGDPAFFLHHGMIDRVWWIWQSLDPKNRRN
AIHGTGTFLNQPPSPNTTLDTLIDLGHAGGSVRPMRDLMSTTDGPFCYTYL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaaggctttaagcgttggcttctttctctcccaggtcctggctgtacccgcg
ccgagggttgatgctgatgccattccctttagaattccgccctctgcggcctcctccatc
cccgaggcacagtctcagctcgacggcctggcttcatttgcctatggtgtgaccaagtcg
aatctagaatcgggctcggagaggagacgcacgaacgcctgcacgttgtcgaatctcagc
gtccgccgtgaatggtcaaccttcacggtgaggcagagaaaggcgtacattgatgccgtg
ctctgcctgcagaagctgccggcaaagacgccgtccagcattgctaccggagctaaaagt
cgctatgatgactttgtcgccactcacgtccagcagacgttgggaatccaccataccggc
acattccttgcgtggcataggtattacgtccacgaatatgatcaggcccttcgcaatgaa
tgttcatacaagggcgactatccctattgggattggccgctttccgccgtgattgggatg
gaaaaccaccccatctttgacggcagtgacacatccttgtccggcaacggcaaacccatc
cccaaccagggtgacattgtagtccgcatagcagatttcccgccagtgaacctaccatcc
ggtaccgggggcgggtgcgtcaccagcgggccgttcaaagactatgtcgtgaaccttgga
ccagcggtgctcctcctccccggtgacaaagtcgaattccgccccaacccgctcgaccac
aatccacgctgcttgaagcgtgatctcaccgataccgttatcaagaaatacgccaatgct
accgccgtggtggacctgatcctccgcagcaaagacatcgaatccttccagacaaccatg
cagggcgccctcggcagcgactccgttggcgtccatggcggggggcactttgctctcggc
ggtgatccagggcgcgatgtgttcgtctcccccggcgacccggcgtttttccttcaccat
ggcatgatcgatcgagtgtggtggatctggcagagcttggatccgaagaaccgccgcaac
gcgattcacggaacagggacattcttgaaccaacccccgtctcccaatacgacgcttgat
acgctgattgacctgggtcatgcgggtggttctgtgcggcccatgcgcgatttgatgagt
accacggatggaccattctgctatacctatctgtaa

DBGET integrated database retrieval system