KEGG   Uncinocarpus reesii: UREG_07865Help
Entry
UREG_07865        CDS       T01132                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ure  Uncinocarpus reesii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ure00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    UREG_07865
Translation factors [BR:ure03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    UREG_07865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 234 aa AA seqDB search
MHGESWDAAEDSEVEREKKAKEAAAKAKAEAEAAAKKKSKAQRINEHRARRQADAEEEES
SDEEEDAAEQRARLKRTEQDSDLKHAEDLFGDIDLNRSRSAPKTAVVSDTGDPTKSIDLS
SIPLFKPGTKAQFTALTNTLAPLLAAQSKKPQYSLWVQDFAKQLVKELPSTEIKKVASAL
TAASNEKLKEEKAADKGGKKTKAAKTKTSLVTTHSNRMDTTAYDGEDLDDDDFM
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcacggtgaatcttgggacgcggctgaagattcagaagtcgaacgagagaagaaagcg
aaagaagctgccgccaaagccaaggccgaagctgaagctgctgcaaagaagaagtcgaaa
gcgcaaaggataaacgaacacagggcacgacggcaagctgatgcggaggaagaggagtct
agtgatgaggaggaggatgctgcagagcaacgggcgcggttgaagcgaacagagcaagac
tctgatttgaagcatgcggaagatctctttggcgatatcgatctcaaccggagccgctcg
gcacctaagacggcagtagtttctgataccggtgatcctacgaagtctattgatctttcc
tcaatcccgctattcaagccaggcaccaaggcccaattcacggctcttacgaataccctt
gctcctctcctcgccgcccagtccaagaagccacaatattctctctgggttcaggatttt
gcgaagcaacttgttaaggagcttcccagcacagaaatcaaaaaggtggccagcgctttg
accgcggctagcaacgaaaagctcaaggaggagaaagctgcagacaagggtgggaagaag
accaaagccgcgaagacgaagacaagtctagttacgactcactcgaaccgcatggatacg
acagcttacgatggcgaggatttggacgatgacgattttatgtga

DBGET integrated database retrieval system