KEGG   Ureaplasma urealyticum serovar 10 ATCC 33699: UUR10_0041Help
Entry
UUR10_0041        CDS       T00781                                 

Definition
restriction-modification enzyme subunit s3b
Orthology
K01154  
type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
uue  Ureaplasma urealyticum serovar 10 ATCC 33699
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
45017..46237
Genome map
AA seq 406 aa AA seqDB search
MSIKLKDIIYAKRGSTITSNEFKINPGSYPLISASAQNNGVFGYINYYMYEGGHITISMN
GNAGCVFYQKDKFSANSDVLVLSNIDNKISNNKFIFYWLKKHENTKIKSLCKGTTRLRLS
NDDVLNLEINLPPIEEQNAIISIIEPHEKLFIKYSNLVDISSVENTKKDVDNLISIIEPI
ERIIKNLKAIKYKLETIMNNFFVVFYLFNNEENSNKYKLRNIGKFKGGISTLDKNNYDSG
INFINYMDIYKNFVINDDIKLRLYNASEKDIKSYIVSYGDLLLTASSETKEEIAFSSVYL
SNKQAIFNGFSKIYKYDQNILLPIYAAFYFRSEFFRKEVIKLATGYTRFNLSIKDAKNIE
ISINNFEFQKKFSKIVEPLLNLSTKANKIEKILNDSLLKITKKLIV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaaattaaaagacataatttatgctaaaagaggaagcactataacgtctaat
gaatttaaaataaatcctggttcatatccgttaatatctgcaagtgctcaaaataatgga
gtgtttggttacattaattattatatgtatgagggtggacacataaccatttctatgaat
ggtaacgctggttgtgttttttaccaaaaagacaaattttccgctaattctgatgtacta
gtattaagtaatattgataataaaatatcaaataataagtttattttttattgactaaaa
aaacatgaaaacactaagataaaatctttatgtaaaggaactactagattgagactaagt
aatgatgatgttttgaatttagaaattaacttaccaccaatagaagaacaaaatgcaata
atttcgattattgaaccacatgaaaagttgtttataaaatactctaatttagttgatata
tcaagtgtagaaaacactaaaaaagatgttgataacttaatttcgattattgaaccaata
gaaagaataataaagaatttaaaagcaataaaatataaattagaaacgataatgaataat
ttttttgttgttttttatttgtttaataatgaagaaaattcaaacaaatataaattaaga
aatattggtaaatttaaaggtggaatttctactctagataaaaataactatgatagtgga
ataaattttattaactatatggatatatataaaaattttgtgataaatgatgatataaag
ttaaggttgtataatgctagtgaaaaagacataaaatcatatatagtgtcttatggagac
ttattactaacagcgagctctgaaacaaaagaagaaattgcattttcttcagtttatctt
tcaaataaacaagcaatttttaatggtttttcaaaaatatataaatatgatcaaaatatt
ttattaccaatatatgctgcattttattttcgatctgaattttttagaaaagaagtaata
aaattagcaacaggttatactagatttaatttaagtattaaagatgctaaaaacattgaa
attagtattaataatttcgaattccaaaaaaaattttctaaaattgttgaaccattacta
aatttgtctacaaaagctaataaaattgaaaaaattttaaatgattctttattaaaaatt
actaaaaaactaatagtttaa

DBGET integrated database retrieval system