KEGG   Ureaplasma urealyticum: UUR10_0101Help
Entry
UUR10_0101        CDS       T00781                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
uue  Ureaplasma urealyticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:uue00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UUR10_0101 (recR)
DNA repair and recombination proteins [BR:uue03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      UUR10_0101 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118369..118974
Genome map
AA seq 201 aa AA seqDB search
MSKPVEFEMLVDALKSLPGVGTKNAKKWAFFLLQQDQKYIDDFIKRIKDAKTNIIKCKYC
SNFGNKDECDICSNDYRDFTKLMIVTTNEDLERIESANIYNGLYHITNGEVSLRKNVVIE
HTNIKIIKERVLNGSFKEIIIATSYTHDGEVTADYIVKMLEDIKDIQIYRIGFGIPLNSS
IDYADDETLKQSIANKRKIRI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccagttgaatttgaaatgcttgttgacgcactaaaatcattacctggtgta
ggaacaaaaaatgctaagaaatgagcattttttttattacaacaagatcaaaaatatatt
gatgattttattaaaagaattaaagatgcaaaaacaaatattataaaatgcaagtattgt
agtaattttgggaataaagatgaatgtgatatttgttcaaatgattatcgtgactttact
aagttaatgattgttactacaaatgaagatttagaaagaattgaatcagcaaatatttat
aatggtttatatcacattacaaatggtgaagtttctttaagaaaaaacgttgttattgaa
catacaaatattaaaataattaaagaacgtgttttaaatggtagttttaaagaaataatt
attgcaacaagttatactcatgatggagaagttacggctgattacattgtaaaaatgctt
gaagatattaaagatatccaaatttatcgcattggttttggcatccctttaaattcaagt
attgattatgcagatgatgaaactttaaaacaatctattgctaataaacgaaaaattaga
atttaa

DBGET integrated database retrieval system