KEGG   Ureaplasma urealyticum: UUR10_0176Help
Entry
UUR10_0176        CDS       T00781                                 

Definition
phosphofructokinase family protein (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
uue  Ureaplasma urealyticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:uue00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UUR10_0176
   01230 Biosynthesis of amino acids
    UUR10_0176
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UUR10_0176
   00030 Pentose phosphate pathway
    UUR10_0176
   00051 Fructose and mannose metabolism
    UUR10_0176
   00052 Galactose metabolism
    UUR10_0176
  Energy metabolism
   00680 Methane metabolism
    UUR10_0176
Enzymes [BR:uue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UUR10_0176
Protein phosphatases and associated proteins [BR:uue01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UUR10_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206772..207737
Genome map
AA seq 321 aa AA seqDB search
MSQTSFLNSTKNILIITSGGDAPGMNASLVSLIHELMDSNFNVFVGIEGLLGLYNNLIEP
IKNKHIFDVYFKEQGTIIKTSRFIKLNVNDEKTQVIKKNLLEHNIHKIIILGGQGSMQAG
LVLTDLGFEVYGILHTIDNDFNQTQMCIGASSAAHFNQQLLTCLNYTAKAHNAFSLVEIM
GHQCPWLVNNSIGQLKPILTLTNQDPKYSVDQVIDLVKTKITLAKEYDPLIIVQELIYDQ
QWYEALKKAFAQKLHQTLRVTILNYLQRGAPVIDFDLQLAKDSASVLVDFIINKNEIENT
SNMYVVVNKNDIKPQVIKFND
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacaagttttttaaattcaactaaaaatattttaattattacttcaggtggt
gatgcaccaggaatgaatgcttctttagtttctttaattcatgaattaatggatagtaat
ttcaatgtttttgtaggaattgaaggactattaggattgtataataatttaattgaacca
attaaaaataaacatatctttgatgtttattttaaagaacaaggaacaattattaaaaca
agtcgttttattaaattaaatgttaatgatgaaaaaacacaagtaattaaaaagaattta
ttagaacataacatacacaagatcattattttaggtggtcaaggaagtatgcaagcaggt
ttggtactaacagatttaggttttgaagtttatggtatattacatacaattgataatgat
tttaaccaaacacaaatgtgtattggtgcatcaagtgctgcacattttaatcaacaatta
ctaacatgtttaaattacacagcaaaagctcataatgcttttagtttagttgaaattatg
ggccatcaatgtccatgattagttaataatagtattggacaactaaaaccaatcttaact
ttaactaatcaggatccaaaatatagtgttgatcaagtgattgatttagttaaaactaaa
ataactttagctaaagaatatgatccattaattattgttcaagaattaatttatgatcaa
caatgatatgaagcattaaaaaaagcctttgctcaaaaattacatcaaaccttacgagtg
acaattttaaattatttacaacgaggagctccagtaattgattttgatctacaattagca
aaagatagtgctagtgtattagttgattttattattaataaaaacgaaattgaaaataca
agtaatatgtatgtagttgttaataaaaatgacattaaaccacaagttattaaatttaat
gattag

DBGET integrated database retrieval system