KEGG   Ureaplasma urealyticum: UUR10_0176Help
Entry
UUR10_0176        CDS       T00781                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
uue  Ureaplasma urealyticum
Pathway
uue00010  Glycolysis / Gluconeogenesis
uue00030  Pentose phosphate pathway
uue00051  Fructose and mannose metabolism
uue00680  Methane metabolism
uue01100  Metabolic pathways
uue01110  Biosynthesis of secondary metabolites
uue01120  Microbial metabolism in diverse environments
uue01130  Biosynthesis of antibiotics
uue01200  Carbon metabolism
uue01230  Biosynthesis of amino acids
uue03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:uue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UUR10_0176
   00030 Pentose phosphate pathway
    UUR10_0176
   00051 Fructose and mannose metabolism
    UUR10_0176
   00052 Galactose metabolism
    UUR10_0176
  Energy metabolism
   00680 Methane metabolism
    UUR10_0176
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    UUR10_0176
Enzymes [BR:uue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UUR10_0176
Protein phosphatases and associated proteins [BR:uue01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UUR10_0176
Messenger RNA biogenesis [BR:uue03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     UUR10_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACI60029
UniProt: B5ZAZ1
Position
206772..207737
Genome map
AA seq 321 aa AA seqDB search
MSQTSFLNSTKNILIITSGGDAPGMNASLVSLIHELMDSNFNVFVGIEGLLGLYNNLIEP
IKNKHIFDVYFKEQGTIIKTSRFIKLNVNDEKTQVIKKNLLEHNIHKIIILGGQGSMQAG
LVLTDLGFEVYGILHTIDNDFNQTQMCIGASSAAHFNQQLLTCLNYTAKAHNAFSLVEIM
GHQCPWLVNNSIGQLKPILTLTNQDPKYSVDQVIDLVKTKITLAKEYDPLIIVQELIYDQ
QWYEALKKAFAQKLHQTLRVTILNYLQRGAPVIDFDLQLAKDSASVLVDFIINKNEIENT
SNMYVVVNKNDIKPQVIKFND
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacaagttttttaaattcaactaaaaatattttaattattacttcaggtggt
gatgcaccaggaatgaatgcttctttagtttctttaattcatgaattaatggatagtaat
ttcaatgtttttgtaggaattgaaggactattaggattgtataataatttaattgaacca
attaaaaataaacatatctttgatgtttattttaaagaacaaggaacaattattaaaaca
agtcgttttattaaattaaatgttaatgatgaaaaaacacaagtaattaaaaagaattta
ttagaacataacatacacaagatcattattttaggtggtcaaggaagtatgcaagcaggt
ttggtactaacagatttaggttttgaagtttatggtatattacatacaattgataatgat
tttaaccaaacacaaatgtgtattggtgcatcaagtgctgcacattttaatcaacaatta
ctaacatgtttaaattacacagcaaaagctcataatgcttttagtttagttgaaattatg
ggccatcaatgtccatgattagttaataatagtattggacaactaaaaccaatcttaact
ttaactaatcaggatccaaaatatagtgttgatcaagtgattgatttagttaaaactaaa
ataactttagctaaagaatatgatccattaattattgttcaagaattaatttatgatcaa
caatgatatgaagcattaaaaaaagcctttgctcaaaaattacatcaaaccttacgagtg
acaattttaaattatttacaacgaggagctccagtaattgattttgatctacaattagca
aaagatagtgctagtgtattagttgattttattattaataaaaacgaaattgaaaataca
agtaatatgtatgtagttgttaataaaaatgacattaaaccacaagttattaaatttaat
gattag

DBGET integrated database retrieval system