KEGG   Ureaplasma urealyticum serovar 10 ATCC 33699: UUR10_0207Help
Entry
UUR10_0207        CDS       T00781                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
uue  Ureaplasma urealyticum serovar 10 ATCC 33699
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:uue00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243477..244049
Genome map
AA seq 190 aa AA seqDB search
MKRGKLIVFSGPSGVGKHTILSKIIDRKELNLAYSVSMTTRKKREGEINGVDYYFVNDEE
FKKAISNNELIEWAEFVGNKYGTPRFVVEKLRNEGKNVILEIEVVGALQVLELFKNDDLI
SIFLLPPSLDELKNRLLKRNTETLETIEKRIQKASHELSIKDHYKYNIINDNPDHAANQL
AEIILDEIKR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggggaaaattaattgtttttagtggacctagtggtgtaggcaaacacacaatt
ttatcaaaaattattgatcgtaaagaattaaatttagcatatagcgtttcaatgacgaca
agaaaaaaacgtgaaggcgaaatcaatggcgttgattattattttgttaatgatgaagag
tttaaaaaagctatatctaataacgaattaattgaatgagccgaatttgttggaaataaa
tatggaacaccacgatttgttgtggaaaaattaaggaatgaaggtaaaaatgtaatttta
gaaattgaagttgttggtgcacttcaggttttagaattatttaaaaatgacgatttaatc
tctatttttttattaccacctagtcttgatgaattaaaaaatcgattactaaaaagaaat
actgaaactttagaaacaattgaaaaacgaattcaaaaagctagtcatgaactatcaatc
aaagatcattataaatacaacattattaatgataatccagatcatgcagccaaccagtta
gcggagattattttagatgaaattaaacgataa

DBGET integrated database retrieval system