KEGG   Ureaplasma urealyticum: UUR10_0484Help
Entry
UUR10_0484        CDS       T00781                                 

Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
uue  Ureaplasma urealyticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:uue00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UUR10_0484
Enzymes [BR:uue01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     UUR10_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(533677..534264)
Genome map
AA seq 195 aa AA seqDB search
MNYLVFKVIYANANVVIGEHNFIGYQIRVPKDYELEVNKFCKLYLYEYASIMPNKNLIIK
DLYGFRTYNERLLFIDLISINSIGPKTAINILKYDINLIIDAIATKDVDFLATIKGVNQR
SANLICDQLNYKYINKVSEKNPWAKELSIGLENLGYDKKDIEYAITKVKVDTQQNIDISE
IIGCAIKEISLRHEN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaactatttggtttttaaagttatttatgcgaatgcaaacgttgttattggtgaacac
aattttattggttatcaaattcgtgtgccaaaagattatgaattagaagtcaataagttt
tgtaaattatacttatatgagtatgctagtataatgcctaataaaaatttaattattaaa
gatttatatggttttcgcacttataatgaacgattattatttattgatttaattagtatt
aattctattggaccaaaaacagctattaatattttaaaatatgatattaacttaataatt
gatgcgatcgctactaaagatgttgattttttagcaactattaaaggtgttaaccaacgc
agtgctaatttaatttgcgatcaactaaactataaatatatcaataaagttagtgagaaa
aatccttgagctaaagaattaagtattggtcttgaaaatttaggttatgataaaaaagat
attgaatatgcaatcactaaagttaaagttgatacacagcaaaacattgatattagtgaa
attataggatgtgctattaaagaaatttctttacgccatgaaaactaa

DBGET integrated database retrieval system