KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU114Help
Entry
UU114             CDS       T00040                                 

Gene name
folA
Definition
dihyrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UU114 (folA)
   00670 One carbon pool by folate
    UU114 (folA)
Enzymes [BR:uur01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     UU114 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150369..150839
Genome map
AA seq 156 aa AA seqDB search
MLKLIWCQTLNGGISKNNKLPWYIKEELDHFYKTTKNHKIIMGKNTFDSLDQKPLNNRTN
IIFSSIMQTPEDESYFVTNDFQQVLNDAKKEDIFIIGGKELFDIFLAYADVLIVSVLKDY
YDCDLYMKVDYNNFNLDKQDVYDNFIVNYYSNKKEK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagttaatttgatgtcaaacattgaatggtggtatatcaaaaaataataaatta
ccatgatatataaaagaagaattagatcatttttataaaacaacaaaaaaccataaaatt
ataatgggtaaaaacacttttgattcattagatcaaaaaccattaaataatcgaacaaat
atcattttttcttcaattatgcaaacaccagaagacgaatcgtattttgtgacaaatgat
tttcaacaagtattaaacgatgctaaaaaagaggatatttttattattggcggcaaggaa
ttatttgatatttttttagcttatgcagatgttttaattgtttctgtattaaaagattat
tatgattgtgatctatacatgaaagttgattataataattttaatttagataaacaagat
gtttatgataattttattgttaattattattcaaataagaaggaaaaataa

DBGET integrated database retrieval system