KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU114Help
Entry
UU114             CDS       T00040                                 

Gene name
folA
Definition
dihyrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:uur00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:uur00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150369..150839
Genome map
AA seq 156 aa AA seqDB search
MLKLIWCQTLNGGISKNNKLPWYIKEELDHFYKTTKNHKIIMGKNTFDSLDQKPLNNRTN
IIFSSIMQTPEDESYFVTNDFQQVLNDAKKEDIFIIGGKELFDIFLAYADVLIVSVLKDY
YDCDLYMKVDYNNFNLDKQDVYDNFIVNYYSNKKEK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagttaatttgatgtcaaacattgaatggtggtatatcaaaaaataataaatta
ccatgatatataaaagaagaattagatcatttttataaaacaacaaaaaaccataaaatt
ataatgggtaaaaacacttttgattcattagatcaaaaaccattaaataatcgaacaaat
atcattttttcttcaattatgcaaacaccagaagacgaatcgtattttgtgacaaatgat
tttcaacaagtattaaacgatgctaaaaaagaggatatttttattattggcggcaaggaa
ttatttgatatttttttagcttatgcagatgttttaattgtttctgtattaaaagattat
tatgattgtgatctatacatgaaagttgattataataattttaatttagataaacaagat
gtttatgataattttattgttaattattattcaaataagaaggaaaaataa

DBGET integrated database retrieval system