KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU181Help
Entry
UU181             CDS       T00040                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:uur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UU181 (tpiA)
   01230 Biosynthesis of amino acids
    UU181 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UU181 (tpiA)
   00051 Fructose and mannose metabolism
    UU181 (tpiA)
   00562 Inositol phosphate metabolism
    UU181 (tpiA)
Enzymes [BR:uur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UU181 (tpiA)
Exosome [BR:uur04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UU181 (tpiA)
  Exosomal proteins of bladder cancer cells
   UU181 (tpiA)
  Exosomal proteins of melanoma cells
   UU181 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
218524..219240
Genome map
AA seq 238 aa AA seqDB search
MKYIIANFKMNATQELINHFLNNLTLFDEQKIIIGLAPGDLYLKTFVNLAEIKKVNLYAQ
NPSLHNKGPYTGQISCLQLLDINIKNALVGHSEIRIDFSQSIIDQKIKISMDLLEQVIIC
VGETFDAYKQNKSLNFVLNQLANIINYKGLKKIIIAYEPIWAIGTDLELDFKHINYMIEG
IKTYLYNCTGINIPILYGGSVNDNNINELCNQKLIDGFLIGNASLDVNVFNKIIDKCK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattattgctaattttaaaatgaatgcaacacaagaattaattaatcatttt
ttaaataatttaacgttatttgatgagcaaaaaattattattggtttagcaccaggggat
ttatatttaaaaacatttgttaatttagctgaaataaaaaaagtcaatttatatgctcaa
aacccatcattacataataaaggaccttatacaggtcaaataagttgtttacaattatta
gatattaatattaaaaatgctttagttgggcatagtgaaatacgtattgatttttcacaa
tcaataattgatcaaaaaataaaaatatctatggatttattagaacaagtcatcatttgt
gttggcgaaacttttgatgcttataaacaaaataaatcacttaattttgttttaaatcaa
ttagccaacatcattaattacaaaggattaaaaaaaattattatcgcttatgaaccaatt
tgagcaattggcactgatttagaattagattttaaacatattaattacatgatcgaagga
attaaaacatatttatataattgtactggaataaatattcctattttatatggcggtagt
gttaatgacaataatattaatgaattgtgcaatcaaaaattaatcgatggttttttaatt
ggcaatgcttcattagatgttaatgtttttaataaaattatcgataaatgtaaataa

DBGET integrated database retrieval system