KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU185Help
Entry
UU185             CDS       T00040                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
uur00010  Glycolysis / Gluconeogenesis
uur00030  Pentose phosphate pathway
uur00051  Fructose and mannose metabolism
uur00680  Methane metabolism
uur01100  Metabolic pathways
uur01110  Biosynthesis of secondary metabolites
uur01120  Microbial metabolism in diverse environments
uur01130  Biosynthesis of antibiotics
uur01200  Carbon metabolism
uur01230  Biosynthesis of amino acids
uur03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:uur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UU185 (pfkA)
   00030 Pentose phosphate pathway
    UU185 (pfkA)
   00051 Fructose and mannose metabolism
    UU185 (pfkA)
   00052 Galactose metabolism
    UU185 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    UU185 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    UU185 (pfkA)
Enzymes [BR:uur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UU185 (pfkA)
Protein phosphatases and associated proteins [BR:uur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UU185 (pfkA)
Messenger RNA biogenesis [BR:uur03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     UU185 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Spatacsin_C
Motif
Other DBs
NCBI-ProteinID: AAF30592
UniProt: Q9PQV8
Position
223081..224046
Genome map
AA seq 321 aa AA seqDB search
MNQVNFLNLDKNILIITSGGDAPGMNASLISLIHRLMNNNFNVFIGIEGLLGLYNNLIEP
IKDKRVFDVYFNEQGTVIKTSRFIKLDINDKKTQIIKDNLLSHNIQKIIILGGQGSMQAG
LVLTKMGFEVFGILHTIDNDFSETQMCIGALSAASFNQKLLKCLNYTAKAHCAFNLVELM
GRECSWLVNNSVGKLKPILMLTNQDNKYTVDEVIDLIKDKINSIKEYDPLIIVQELIYDQ
KWYELLVKTFEQKLHKSLRITILNYLQRGAPVSDFDLQLAKDSANVLVDFIVNQNDIKNT
NNMYVVINKFDNKLEVIKFNK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagtaaattttttaaatttagataaaaatattttaattattacttcaggtggt
gatgcaccgggtatgaatgcttcattaatttcattaatccatagattaatgaataataat
tttaatgtttttataggaattgaaggattattaggactgtacaataatttaattgaacca
attaaagataaacgtgtttttgatgtttattttaacgagcaaggaacagtcattaagaca
agtagatttattaaattagatattaatgataaaaaaacacaaattattaaagataattta
ttaagtcataatattcaaaaaattattatcttaggcggccaaggtagtatgcaagctggt
ttagtgttaacaaaaatgggctttgaagtctttggaatattacacactattgataatgat
tttagtgaaacacaaatgtgtataggggccttaagtgctgcttcttttaatcaaaaatta
ttaaagtgcctaaattacacagcaaaagctcattgtgcttttaatttagttgagcttatg
ggtcgtgaatgttcatgattagtcaataatagtgttggtaaattaaaacctattttaatg
ttaactaatcaagataataaatatactgttgatgaagtaatagatttaattaaagataaa
ataaactcaataaaagaatacgatcctttaatcattgttcaagaattaatctatgatcaa
aaatgatacgaattattagtaaaaacttttgagcaaaaattacataaaagtttacgaatt
acaattttaaattatttacaacgcggagctccagtaagtgattttgatttacaattagca
aaagatagtgcgaatgtattggttgattttattgttaatcaaaatgatataaaaaacaca
aataatatgtatgtagttattaataagtttgataataagttagaagttattaaattcaat
aaatag

DBGET integrated database retrieval system