KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU185Help
Entry
UU185             CDS       T00040                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:uur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UU185 (pfkA)
   01230 Biosynthesis of amino acids
    UU185 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UU185 (pfkA)
   00030 Pentose phosphate pathway
    UU185 (pfkA)
   00051 Fructose and mannose metabolism
    UU185 (pfkA)
   00052 Galactose metabolism
    UU185 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    UU185 (pfkA)
Enzymes [BR:uur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UU185 (pfkA)
Protein phosphatases and associated proteins [BR:uur01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UU185 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223081..224046
Genome map
AA seq 321 aa AA seqDB search
MNQVNFLNLDKNILIITSGGDAPGMNASLISLIHRLMNNNFNVFIGIEGLLGLYNNLIEP
IKDKRVFDVYFNEQGTVIKTSRFIKLDINDKKTQIIKDNLLSHNIQKIIILGGQGSMQAG
LVLTKMGFEVFGILHTIDNDFSETQMCIGALSAASFNQKLLKCLNYTAKAHCAFNLVELM
GRECSWLVNNSVGKLKPILMLTNQDNKYTVDEVIDLIKDKINSIKEYDPLIIVQELIYDQ
KWYELLVKTFEQKLHKSLRITILNYLQRGAPVSDFDLQLAKDSANVLVDFIVNQNDIKNT
NNMYVVINKFDNKLEVIKFNK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagtaaattttttaaatttagataaaaatattttaattattacttcaggtggt
gatgcaccgggtatgaatgcttcattaatttcattaatccatagattaatgaataataat
tttaatgtttttataggaattgaaggattattaggactgtacaataatttaattgaacca
attaaagataaacgtgtttttgatgtttattttaacgagcaaggaacagtcattaagaca
agtagatttattaaattagatattaatgataaaaaaacacaaattattaaagataattta
ttaagtcataatattcaaaaaattattatcttaggcggccaaggtagtatgcaagctggt
ttagtgttaacaaaaatgggctttgaagtctttggaatattacacactattgataatgat
tttagtgaaacacaaatgtgtataggggccttaagtgctgcttcttttaatcaaaaatta
ttaaagtgcctaaattacacagcaaaagctcattgtgcttttaatttagttgagcttatg
ggtcgtgaatgttcatgattagtcaataatagtgttggtaaattaaaacctattttaatg
ttaactaatcaagataataaatatactgttgatgaagtaatagatttaattaaagataaa
ataaactcaataaaagaatacgatcctttaatcattgttcaagaattaatctatgatcaa
aaatgatacgaattattagtaaaaacttttgagcaaaaattacataaaagtttacgaatt
acaattttaaattatttacaacgcggagctccagtaagtgattttgatttacaattagca
aaagatagtgcgaatgtattggttgattttattgttaatcaaaatgatataaaaaacaca
aataatatgtatgtagttattaataagtttgataataagttagaagttattaaattcaat
aaatag

DBGET integrated database retrieval system