KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU280Help
Entry
UU280             CDS       T00040                                 

Gene name
celM
Definition
(GenBank) Endo-1,4-beta-glucanase
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
315422..316513
Genome map
AA seq 363 aa AA seqDB search
MSKFNEKEIRNKAIEYMEIYGMSRHEERVASKLKASLKDAGVDYERDNLGSIIFKKTNSN
KGPKILIATHMDEVGFVVQQILDNGQLLLSMVGGVWPNIAIGSVAKVYVDEQRQYTGVFG
HTSIHILEPEARSKAVPVKELFVDCGFNSKQQAIDLGIEIGTEVYMEGPTLNFYDENYIV
GKAVDNRVSVAVLDLLIHSLKDKVIPNQTYFAATVQEEVGLRGAKTVVSKVKPDIGIVID
TTTSHDTYKCPEGDTKLNDGVCIRIKDGGTLVNPKLVKYFEELAIKHNIPLYKYVARGGG
TDAEELQYGPNGGVLTIGLSIPQRYLHAPIGVATVKDIKAAFDLVREFLEVFDENEFEKV
KFK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatttaacgaaaaagaaattagaaataaagcaattgaatatatggaaatatat
ggtatgtcacgtcatgaagaacgtgttgcttccaaactaaaagcatcattaaaagatgcg
ggagttgattatgaacgtgataatttaggttcaattatttttaaaaaaacaaattcaaat
aaaggacctaaaatcttaattgctacacacatggatgaagttggttttgtagttcaacaa
attcttgataatggtcaattactattatcaatggtaggtggtgtatggcctaatattgct
attggatcagtagcaaaagtgtatgttgatgaacaacgtcaatatactggtgtatttggc
catacttcaattcatatcttagaacctgaagcacgcagtaaagcagttccagttaaagaa
ttatttgttgattgcggttttaattcaaaacaacaagctattgatttaggaattgaaata
ggtacggaagtttatatggaaggaccaactttaaatttttatgatgaaaattatattgtt
ggtaaagctgttgataatcgtgtaagtgttgcggttttagatttattaatacatagttta
aaggacaaagtaattcccaaccaaacttattttgctgcaacagtgcaagaagaagttgga
ttacgtggcgcaaaaacagttgtttcaaaagtaaaacctgatattgggattgttattgat
acaacaacatcacacgatacatacaagtgtccagagggtgatacaaaattaaatgatggt
gtatgtattagaattaaagatggtggaactttagttaatcctaaattagtaaaatatttt
gaagaattagctattaaacacaacattcctttatataaatatgttgcacgaggaggcggg
actgatgctgaagaattgcaatatgggcctaatggtggagtattaacaattggtttgtct
atcccacaacgttatttacatgctccaattggcgtagcaacggttaaagatataaaagca
gcctttgacttagtacgtgagtttttagaagtatttgatgaaaacgaatttgaaaaagta
aaatttaaataa

DBGET integrated database retrieval system