KEGG   Ureaplasma parvum serovar 3 ATCC 700970: UU368Help
Entry
UU368             CDS       T00040                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
uur  Ureaplasma parvum serovar 3 ATCC 700970
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uur00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    UU368 (deoA)
Enzymes [BR:uur01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     UU368 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
418752..420053
Genome map
AA seq 433 aa AA seqDB search
MLNVVEIISKKKNNIELSEQEIKFVYDGFVNKTIPDYQMAAFLMAVNFCGYSENEQYYAT
KAMVESGKLLDLRVENKIVVDKHSSGGVGDKVSIILTPLLSALGLYVGKMSGRGLGHTGG
TVDKLESLNLNLDFDLKTYMNQLKDNGLLLTGQSDDMVVADKYIYALRDVTATSDVFDLM
IGSIMAKKLALITDYIFLDVKVGEGAFCKNVAQAESLATKMLKLSKKFNRNTIIHLTNMD
QPLGKAIGNAIEIKESMDYLLGKPVPQDLYDLINQFALDILIDTKFAKNKEDAQSKIDNV
IKNGLAYQKFVNWVKWYKGDYISLENDTYFNPKYKLEILAKQDGYLDFKSTKELGMIAVD
LKAGRKVKTDQLDFQAGIYLNKKNNDFVKTNEVIATLYASEPINDEVVNKYHNNVVYLKT
PKQIAPSIIKVMR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgttgtagaaattattagcaagaaaaaaaataatattgaattaagtgaacaa
gaaattaaatttgtttatgatggttttgttaataagacaattccagattatcaaatggca
gcttttttaatggctgttaatttttgtggatatagtgaaaatgaacaatactatgcaact
aaagcaatggttgaatctggtaaattattagatttgcgtgttgaaaataaaattgttgtt
gacaaacattcatctggtggtgtgggagataaagtttcaattattttaactcctttacta
tcagctttaggattatacgttggaaaaatgtctggtcgaggattagggcatactggtggt
acagttgataaattagaatcattgaatttaaatttagattttgatttaaaaacatacatg
aatcagctaaaagataatggtttattattaactggtcaatcagatgatatggttgtggct
gataaatatatttatgcattacgagatgtaacagcaacaagtgatgtgtttgatcttatg
ataggatcaattatggctaaaaaattagctttaattactgattatattttcttagatgtt
aaagttggtgaaggagcattttgtaaaaatgttgcacaagcagaatctttagcaacaaag
atgttaaaattatcaaagaaatttaatcgtaatacaattatccatttaacaaatatggac
caacctttaggaaaagcaattggtaatgctattgaaattaaagaaagtatggattattta
ttaggtaaaccagtgccccaagatttatatgatttaattaatcagtttgctttagacatc
ttaattgatacaaaattcgctaaaaacaaggaagatgctcaatctaagattgataacgtc
attaaaaatggtttagcttatcaaaaatttgtgaattgagtaaaatgatacaaaggtgat
tatattagtcttgaaaatgatacatattttaaccctaaatacaaattagagattttagca
aaacaagatggatatttagactttaaatcaacaaaagaattgggtatgattgctgttgat
ttaaaagcaggacgtaaagttaaaactgatcaattagattttcaagctggaatttattta
aataagaaaaataatgatttcgttaaaacaaatgaagttattgctacactttatgctagc
gagccaattaatgatgaagttgttaataaataccataacaatgtagtttatttaaaaaca
ccaaaacaaattgcaccatcaattattaaagtaatgcgttaa

DBGET integrated database retrieval system